Crystal structure of REV7(R124A) in complex with a Shieldin3 fragment. Determined by X-ray diffraction at 2.24 Å resolution. Released 11 Dec 2019.
Explore 6K07 in 3D Show helices and sheets RCSB PDB PDBe
6K07 contains 12 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 11-33 | 23 | |
| α-helix | 39-41 | 3 | |
| β-strand | 42-47 | 6 | 1 |
| β-strand | 50-55 | 6 | 1 |
| α-helix | 58-76 | 19 | |
| β-strand | 80-88 | 9 | 2 |
| β-strand | 94-103 | 10 | 2 |
| α-helix | 115-132 | 18 | |
| α-helix | 133-135 | 3 | |
| α-helix | 138-141 | 4 | |
| β-strand | 145-152 | 8 | 2 |
| α-helix | 153 | 1 | |
| α-helix | 159-162 | 4 | |
| β-strand | 171-173 | 3 | 2 |
| α-helix | 174-175 | 2 | |
| α-helix | 184 | 1 | |
| β-strand | 185-193 | 9 | 2 |
| β-strand | 198-205 | 8 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 51-53 | 3 | 2 |
| α-helix | 56-59 | 4 | |
| α-helix | 62-71 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mitotic spindle assembly checkpoint protein MAD2B | A | protein | 219 | Homo sapiens | Q9UI95 (AlphaFold model) |
| Shieldin complex subunit 3 | B | protein | 30 | Homo sapiens | Q6ZNX1 (AlphaFold model) |
>6K07_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A) MGSSHHHHHHSQDPQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPV QMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISS DSLLSHVEQLLAAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWI LADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS
>6K07_2 Shieldin complex subunit 3 (chains B) MGSKLPLRPKRSPPVISEEAAEDVKQYLTI
Structural basis for shieldin complex subunit 3-mediated recruitment of the checkpoint protein REV7 during DNA double-strand break repair. Dai, Y., Zhang, F., Wang, L. et al. J Biol Chem (2020) 295:250-262. DOI 10.1074/jbc.RA119.011464 · PubMed
Other PDB entries of the same protein (UniProt Q9UI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6K07 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.