6M7B: REV7-R124A

Structure of REV7-R124A complexed with SHLD3(37-73). Determined by X-ray diffraction at 1.77 Å resolution. Released 27 Jan 2021.

Method: X-ray diffraction
Resolution: 1.77 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,219
Mol. weight: 57.24 kDa
Released: 27 Jan 2021

Explore 6M7B in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6M7B contains 28 α-helices and 20 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	11-33	23
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-76	19
β-strand	80-88	9	2
β-strand	94-103	10	2
α-helix	115-131	17
α-helix	133-135	3
α-helix	140-142	3
β-strand	145-152	8	2
α-helix	156-159	4
α-helix	160-163	4
β-strand	166	1	3
β-strand	171-173	3	2
α-helix	174-175	2
α-helix	176-179	4
α-helix	184	1
β-strand	185-193	9	2
β-strand	198-205	8	2
α-helix	206-208	3

Chain B: 10 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	11-33	23
α-helix	39-41	3
β-strand	42-47	6	4
β-strand	50-55	6	4
α-helix	58-76	19
β-strand	80-88	9	5
β-strand	94-103	10	5
α-helix	115-131	17
α-helix	133-136	4
α-helix	138-141	4
β-strand	145-152	8	5
α-helix	158-163	6
β-strand	166	1	3
β-strand	171-173	3	5
α-helix	174-175	2
α-helix	176-179	4
α-helix	184	1
β-strand	185-192	8	5
β-strand	198-205	8	5

Chain C: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	49-50	2
β-strand	51-53	3	5
α-helix	56-59	4
α-helix	62-71	10

Chain D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	49-50	2
β-strand	51-53	3	2
α-helix	56-59	4
α-helix	62-72	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A, B	protein	211	Homo sapiens	Q9UI95 (AlphaFold model)
Shieldin complex subunit 3	C, D	protein	37	Homo sapiens	Q6ZNX1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>6M7B_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A, B)
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLAAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Sequence of entity 2 (C, D), FASTA

>6M7B_2 Shieldin complex subunit 3 (chains C, D)
RFIPWFPYDGSKLPLRPKRSPPVISEEAAEDVKQYLT

Primary citation

Structure of REV7-R124A complexed with SHLD3(37-73). Ma, Y.Z., Li, Y., Wu, B.X. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCD 1.43 Å, Crystal structure of Rev7-K44A/R124A/A135D in complex with Rev3-RBM2 (residues 1988-2014)
6BC8 1.68 Å, Crystal structure of Rev7-R124A/Rev3-RBM2 (residues 1988-2014) complex
3ABD 1.9 Å, Structure of human REV7 in complex with a human REV3 fragment in a monoclinic crystal
4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6M7A 1.9 Å, Structure of REV7-R124A complexed with SHLD3(28-73)
6VE5 2.0 Å, X-ray structure of human REV7 in complex with Shieldin3 (residues 41-74)
6NIF 2.0 Å, crystal structure of human REV7-RAN complex
5XPT 2.1 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a tetragonal crystal
6K07 2.24 Å, Crystal structure of REV7(R124A) in complex with a Shieldin3 fragment
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
5XPU 2.3 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a monoclinic crystal
6K08 2.31 Å, Crystal structure of REV7(R124A/A135D) in complex with a Shieldin3 fragment

Browse structure collections

About this viewer

MolViewer shows 6M7B directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.