5XPU: MAD2L2/REV7

Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a monoclinic crystal. Determined by X-ray diffraction at 2.3 Å resolution. Released 20 Sept 2017.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,571
Mol. weight: 28.19 kDa
Released: 20 Sept 2017

Explore 5XPU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XPU contains 9 α-helices and 7 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	39-41	3
β-strand	42-44	3	1
β-strand	53-55	3	1
α-helix	58-75	18
β-strand	80-89	10	2
β-strand	94-101	8	2
α-helix	118-136	19
α-helix	138-141	4
β-strand	144-152	9	2
α-helix	153-154	2
β-strand	171-173	3	2
α-helix	174-175	2
α-helix	192-196	5

Chain B: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	334-336	3	2
α-helix	339-342	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A	protein	227	Homo sapiens	Q9UI95 (AlphaFold model)
Chromosome alignment-maintaining phosphoprotein 1	B	protein	21	Homo sapiens	Q96JM3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XPU_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A)
MGSSHHHHHHSQDPNSMTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQK
RKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQ
PPLLSISSDSLLSHVEQLLAAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQ
VIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Sequence of entity 2 (B), FASTA

>5XPU_2 Chromosome alignment-maintaining phosphoprotein 1 (chains B)
MSNPSASSGPWKPAKPAPSVS

Primary citation

Dynamic feature of mitotic arrest deficient 2-like protein 2 (MAD2L2) and structural basis for its interaction with chromosome alignment-maintaining phosphoprotein (CAMP). Hara, K., Taharazako, S., Ikeda, M. et al. J Biol Chem (2017) 292:17658-17667. DOI 10.1074/jbc.M117.804237 · PubMed

Other PDB entries of the same protein (UniProt Q9UI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCD 1.43 Å, Crystal structure of Rev7-K44A/R124A/A135D in complex with Rev3-RBM2 (residues 1988-2014)
6BC8 1.68 Å, Crystal structure of Rev7-R124A/Rev3-RBM2 (residues 1988-2014) complex
6M7B 1.77 Å, Structure of REV7-R124A complexed with SHLD3(37-73)
3ABD 1.9 Å, Structure of human REV7 in complex with a human REV3 fragment in a monoclinic crystal
4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6M7A 1.9 Å, Structure of REV7-R124A complexed with SHLD3(28-73)
6VE5 2.0 Å, X-ray structure of human REV7 in complex with Shieldin3 (residues 41-74)
6NIF 2.0 Å, crystal structure of human REV7-RAN complex
5XPT 2.1 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a tetragonal crystal
6K07 2.24 Å, Crystal structure of REV7(R124A) in complex with a Shieldin3 fragment
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
6K08 2.31 Å, Crystal structure of REV7(R124A/A135D) in complex with a Shieldin3 fragment

Browse structure collections

About this viewer

MolViewer shows 5XPU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.