4GS0: Tyrosine-protein phosphatase non-receptor type 6

Crystal structure of SHP1 catalytic domain with JAK1 activation loop peptide. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Dec 2012.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,734
Mol. weight: 71.32 kDa
Released: 19 Dec 2012

Explore 4GS0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GS0 contains 28 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	244-257	14
α-helix	258-260	3
α-helix	264-266	3
α-helix	268-273	6
α-helix	283-285	3
β-strand	286	1	1
α-helix	287-289	3
β-strand	304-307	4	1
β-strand	321-324	4	1
α-helix	325-328	4
α-helix	329-331	3
α-helix	332-342	11
β-strand	346-349	4	1
β-strand	354-355	2	2
β-strand	358-359	2	2
α-helix	366-367	2
β-strand	371-374	4	1
β-strand	377-386	10	1
β-strand	390-399	10	1
β-strand	407-414	8	1
α-helix	427-441	15
α-helix	448	1
β-strand	449-452	4	1
α-helix	459-476	18
α-helix	484-492	9
α-helix	502-525	24

Chain B: 13 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	264-266	3
α-helix	268-273	6
α-helix	283-285	3
β-strand	286-288	3	3
α-helix	289	1
β-strand	301-307	7	3
β-strand	321-324	4	3
α-helix	325-328	4
α-helix	329-331	3
α-helix	332-342	11
β-strand	346-349	4	3
β-strand	354-355	2	4
β-strand	358-359	2	4
α-helix	366-367	2
β-strand	371-374	4	3
β-strand	377-386	10	3
β-strand	390-399	10	3
β-strand	407-414	8	3
α-helix	427-441	15
α-helix	448	1
β-strand	449-452	4	3
α-helix	459-476	18
α-helix	484-492	9
α-helix	502-522	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tyrosine-protein phosphatase non-receptor type 6	A, B	protein	308	Homo sapiens	P29350 (AlphaFold model)
Tyrosine-protein kinase JAK1	C	protein	4	Homo sapiens	P23458 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4GS0_1 Tyrosine-protein phosphatase non-receptor type 6 (chains A, B)
MHHHHHHGSLVPRSENLYFQGSGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNIL
PFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAW
QENSRVIVMTTREVEKGRNKCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPL
DNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQINQRQESLPHAGPIIVHCSAGIGRT
GTIIVIDMLMENISTKGLDCDIDIQKTIQMVRAQRSGMVQTEAQYKFIYVAIAQFIETTK
KKLEVLQS

Sequence of entity 2 (C), FASTA

>4GS0_2 Tyrosine-protein kinase JAK1 (chains C)
XXYX

Primary citation

Structure-guided studies of the SHP-1/JAK1 interaction provide new insights into phosphatase catalytic domain substrate recognition. Alicea-Velazquez, N.L., Jakoncic, J., Boggon, T.J. J Struct Biol (2013) 181:243-251. DOI 10.1016/j.jsb.2012.12.009 · PubMed

Other PDB entries of the same protein (UniProt P29350 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4GRZ 1.37 Å, Crystal structure of SHP1 catalytic domain with PO4
4HJP 1.4 Å, SHP-1 catalytic domain WPD loop open
4GRY 1.7 Å, Crystal structure of SHP1 catalytic domain with SO4
8YHI 1.75 Å, The Crystal Structure of SHP1 from Biortus.
4HJQ 1.8 Å, SHP-1 catalytic domain WPD loop closed
1FPR 2.5 Å, Crystal structure of the complex formed between the catalytic domain of shp-1 and an in…
1GWZ 2.5 Å, Crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
6SM5 2.75 Å, MbC/SHP1-C-SH2 complex
2B3O 2.8 Å, Crystal structure of human tyrosine phosphatase SHP-1
3PS5 3.1 Å, Crystal structure of the full-length Human Protein Tyrosine Phosphatase SHP-1
1X6C Solution structures of the SH2 domain of human protein-tyrosine phosphatase SHP-1
2RMX Solution structure of the SHP-1 C-terminal SH2 domain complexed with a…

Browse structure collections

About this viewer

MolViewer shows 4GS0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.