4GXL: Galectin-8 C-CRD

The crystal structure of Galectin-8 C-CRD in complex with NDP52. Determined by X-ray diffraction at 2.02 Å resolution. Released 8 May 2013.

Method: X-ray diffraction
Resolution: 2.02 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,374
Mol. weight: 19.23 kDa
Released: 8 May 2013

Explore 4GXL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4GXL contains 2 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	225-226	2
β-strand	229-232	4	1
β-strand	242-249	8	2
β-strand	255-262	8	1
β-strand	267-275	9	1
β-strand	280-287	8	1
β-strand	290-291	2	1
β-strand	295	1	1
β-strand	308-315	8	2
β-strand	319-324	6	2
β-strand	327-333	7	2
α-helix	339-341	3
β-strand	344-349	6	1
β-strand	351-358	8	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Galectin-8	A	protein	153	Homo sapiens	O00214 (AlphaFold model)
Peptide from Calcium-binding and coiled-coil domain-containing protein 2	B	protein	14	Homo sapiens	Q13137 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4GXL_1 Galectin-8 (chains A)
MGSSHHHHHHSSGENLYFQHMPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSK
DIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNG
VHSLEYKHRFKELSSIDTLEINGDIHLLEVRSW

Sequence of entity 2 (B), FASTA

>4GXL_2 Peptide from Calcium-binding and coiled-coil domain-containing protein 2 (chains B)
ARQNPGLAYGNPYS

Primary citation

Sterical hindrance promotes selectivity of the autophagy cargo receptor NDP52 for the danger receptor galectin-8 in antibacterial autophagy. Li, S., Wandel, M.P., Li, F. et al. Sci Signal (2013) 6:ra9-ra9. DOI 10.1126/scisignal.2003730 · PubMed

Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5GZC 1.08 Å, Crystal structure of Galectin-8 N-CRD with part of linker
9FYJ 1.08 Å, N-terminal domain of human galectin-8 in complex with an alpha-galactoside ligand
5GZD 1.19 Å, Galectin-8 N-terminal domain carbohydrate recognition domain
9FXZ 1.3 Å, Galectin-8 N-terminal carbohydrate recognition domain in complex with…
5GZE 1.32 Å, Galectin-8 N-terminal domain carbohydrate recognition domain
3AP9 1.33 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…
6Z6Y 1.34 Å, Galectin-8 N-terminal domain in complex with a sulfatide mimicking a sphingolipid
7ALS 1.35 Å, Alpha and beta Lactose isomer structure of Galectin 8, N-terminal domain
4BMB 1.35 Å, Crystal structure of the N terminal domain of human Galectin 8
31ML 1.5 Å, Crystal structure of the complex of galectin-8N-Methyl 2,6-anhydro-3-deoxy-3-S-(b-D-galac…
7P1M 1.52 Å, Galectin-8 N-terminal carbohydrate recognition domain in complex with benzimidazole…
3AP7 1.53 Å, Crystal structure of the galectin-8 N-terminal carbohydrate recognition domain in…

Browse structure collections

About this viewer

MolViewer shows 4GXL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.