Structure of the N-terminal domain of RPA70, E100R mutant. Determined by X-ray diffraction at 1.51 Å resolution. Released 11 Sept 2013.
Explore 4IPD in 3D Show helices and sheets RCSB PDB PDBe
4IPD contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-4 | 4 | |
| α-helix | 9-15 | 7 | |
| β-strand | 24-33 | 10 | 1 |
| α-helix | 39-40 | 2 | |
| β-strand | 41-47 | 7 | 1 |
| β-strand | 51-58 | 8 | 1 |
| α-helix | 60-62 | 3 | |
| α-helix | 63-67 | 5 | |
| β-strand | 76-86 | 11 | 1 |
| β-strand | 92-103 | 12 | 1 |
| α-helix | 105-108 | 4 | |
| β-strand | 116-117 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Replication protein A 70 kDa DNA-binding subunit | A | protein | 123 | Homo sapiens | P27694 (AlphaFold model) |
>4IPD_1 Replication protein A 70 kDa DNA-binding subunit (chains A) GSHMVGQLSEGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFM LATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELRVLKSAEAVGVKIGNPVP YNE
Surface Reengineering of RPA70N Enables Cocrystallization with an Inhibitor of the Replication Protein A Interaction Motif of ATR Interacting Protein. Feldkamp, M.D., Frank, A.O., Kennedy, J.P. et al. Biochemistry (2013) 52:6515-6524. DOI 10.1021/bi400542z · PubMed
Other PDB entries of the same protein (UniProt P27694 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4IPD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.