4NB3: RPA70N

Crystal structure of RPA70N in complex with a 3,4 dichlorophenylalanine ATRIP derived peptide. Determined by X-ray diffraction at 1.35 Å resolution. Released 26 Feb 2014.

Method: X-ray diffraction
Resolution: 1.35 Å
Organism: Homo sapiens
Chains: 4
Atoms: 2,832
Mol. weight: 31.43 kDa
Released: 26 Feb 2014

Explore 4NB3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NB3 contains 15 α-helices and 12 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	9-16	8
β-strand	24-32	9	1
α-helix	40	1
β-strand	42-47	6	1
β-strand	51-58	8	1
α-helix	60-62	3
α-helix	63-67	5
β-strand	76-86	11	1
β-strand	92-103	12	1
α-helix	105-108	4
α-helix	115	1
β-strand	116-117	2	1
α-helix	118	1

Chain B: 5 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
α-helix	9-16	8
β-strand	24-32	9	2
β-strand	42-47	6	2
β-strand	51-58	8	2
α-helix	60-62	3
α-helix	63-67	5
β-strand	76-86	11	2
β-strand	92-103	12	2
α-helix	105-108	4
β-strand	116-117	2	2

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-14	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Replication protein A 70 kDa DNA-binding subunit	A, B	protein	123	Homo sapiens	P27694 (AlphaFold model)
3,4 dichlorophenylalanine ATRIP derived peptide	C, D	protein	15		Q8WXE1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4NB3_1 Replication protein A 70 kDa DNA-binding subunit (chains A, B)
GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFM
LATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVP
YNE

Sequence of entity 2 (C, D), FASTA

>4NB3_2 3,4 dichlorophenylalanine ATRIP derived peptide (chains C, D)
XDFTADDLEEWFALA

Primary citation

Discovery of a Potent Stapled Helix Peptide That Binds to the 70N Domain of Replication Protein A. Frank, A.O., Vangamudi, B., Feldkamp, M.D. et al. J Med Chem (2014) 57:2455-2461. DOI 10.1021/jm401730y · PubMed

Other PDB entries of the same protein (UniProt P27694 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4O0A 1.2 Å, Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein…
5E7N 1.21 Å, Crystal Structure of RPA70N in complex with VU0085636
4IPC 1.22 Å, Structure of the N-terminal domain of RPA70, E7R mutant
4R4T 1.28 Å, Crystal Structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)phenylthioamido…
5N8A 1.28 Å, Structure of RPA70N in complex with PrimPol (fragment 480-560)
4R4O 1.33 Å, Crystal structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)benzyl)carbamot…
4R4Q 1.35 Å, Crystal structure of RPA70N in complex with 5-(3-((N-(4-(5-carboxyfuran-2-yl)benzyl)aceta…
4LUV 1.4 Å, Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein…
4R4C 1.4 Å, Structure of RPA70N in complex with 5-(4-((4-(5-carboxyfuran-2-yl)-2-chlorobenzamido)meth…
4R4I 1.4 Å, Structure of RPA70N in complex with 5-(4-((6-(5-carboxyfuran-2-yl)-1-thioxo-3,4-dihydrois…
8K00 1.4 Å, RPA70N-MRE11 fusion
4IJH 1.5 Å, Fragment-based Discovery of Protein-Protein Interaction Inhibitors of Replication…

Browse structure collections

About this viewer

MolViewer shows 4NB3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.