Fragment-Based Discovery of a Potent Inhibitor of Replication Protein A Protein-Protein Interactions. Determined by X-ray diffraction at 1.2 Å resolution. Released 8 Jan 2014.
Explore 4O0A in 3D Show helices and sheets RCSB PDB PDBe
4O0A contains 7 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-4 | 4 | |
| α-helix | 9-11 | 3 | |
| α-helix | 12-16 | 5 | |
| β-strand | 24-32 | 9 | 1 |
| α-helix | 33-34 | 2 | |
| β-strand | 42-47 | 6 | 1 |
| β-strand | 51-58 | 8 | 1 |
| α-helix | 60-62 | 3 | |
| α-helix | 63-67 | 5 | |
| β-strand | 76-86 | 11 | 1 |
| β-strand | 92-103 | 12 | 1 |
| α-helix | 105-108 | 4 | |
| β-strand | 116-117 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Replication protein A 70 kDa DNA-binding subunit | A | protein | 123 | Homo sapiens | P27694 (AlphaFold model) |
>4O0A_1 Replication protein A 70 kDa DNA-binding subunit (chains A) GSHMVGQLSRGAIAAIMQKGDTNIKPILQVINIRPITTGNSPPRYRLLMSDGLNTLSSFM LATQLNPLVEEEQLSSNCVCQIHRFIVNTLKDGRRVVILMELEVLKSAEAVGVKIGNPVP YNE
| ID | Name | Formula | Copies |
|---|---|---|---|
| 2P9 | 5-{4-[({[4-(5-carboxyfuran-2-yl)-2-chlorophenyl]carbonothioyl}amino)methyl]phen… | C29 H18 Cl3 N3 O5 S | 1 |
Discovery of a potent inhibitor of replication protein a protein-protein interactions using a fragment-linking approach. Frank, A.O., Feldkamp, M.D., Kennedy, J.P. et al. J Med Chem (2013) 56:9242-9250. DOI 10.1021/jm401333u · PubMed
Other PDB entries of the same protein (UniProt P27694 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4O0A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.