The Structure of a Triple Mutant of the Tiam1 PH-CC-Ex Domain. Determined by X-ray diffraction at 2.15 Å resolution. Released 10 Jul 2013.
Explore 4K2O in 3D Show helices and sheets RCSB PDB PDBe
4K2O contains 9 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 434-448 | 15 | 1 |
| β-strand | 454-456 | 3 | 1 |
| α-helix | 457-459 | 3 | |
| β-strand | 463-470 | 8 | 1 |
| β-strand | 473-477 | 5 | 1 |
| β-strand | 493-496 | 4 | 1 |
| β-strand | 501-504 | 4 | 1 |
| β-strand | 514-518 | 5 | 1 |
| β-strand | 524-528 | 5 | 1 |
| α-helix | 532-553 | 22 | |
| α-helix | 559-587 | 29 | |
| α-helix | 588-590 | 3 | |
| α-helix | 594-629 | 36 | |
| α-helix | 631-634 | 4 | |
| α-helix | 636-640 | 5 | |
| α-helix | 645-654 | 10 | |
| α-helix | 659-668 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| T-lymphoma invasion and metastasis-inducing protein 1 | A | protein | 276 | Homo sapiens | Q13009 (AlphaFold model) |
>4K2O_1 T-lymphoma invasion and metastasis-inducing protein 1 (chains A) GAAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDGRSGID HNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIHSAC ATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKAAATILDQIFV WEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALV AARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTT
High-resolution structure of the Tiam1 PHn-CC-Ex domain. Joshi, M., Gakhar, L., Fuentes, E.J. Acta Crystallogr Sect F Struct Biol Cryst Commun (2013) 69:744-752. DOI 10.1107/S1744309113014206 · PubMed
Other PDB entries of the same protein (UniProt Q13009 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4K2O directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.