4K2P: Quintuple Mutant of the Tiam1 PH-CC-Ex Domain

The Structure of a Quintuple Mutant of the Tiam1 PH-CC-Ex Domain. Determined by X-ray diffraction at 1.98 Å resolution. Released 10 Jul 2013.

Method: X-ray diffraction
Resolution: 1.98 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,231
Mol. weight: 124.86 kDa
Ligands: CA
Released: 10 Jul 2013

Explore 4K2P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4K2P contains 31 α-helices and 32 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	436-449	14	1
β-strand	453-456	4	1
α-helix	457-458	2
β-strand	463-470	8	1
β-strand	473-477	5	1
β-strand	493-496	4	1
β-strand	501-504	4	1
β-strand	514-518	5	1
β-strand	524-528	5	1
α-helix	532-554	23
α-helix	559-587	29
α-helix	594-629	36
α-helix	632-635	4
α-helix	636-640	5
α-helix	645-654	10
α-helix	659-667	9

Chain B: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	436-449	14	2
β-strand	453-456	4	2
α-helix	457-458	2
β-strand	463-470	8	2
β-strand	473-477	5	2
β-strand	493-496	4	2
β-strand	501-504	4	2
β-strand	514-518	5	2
β-strand	524-528	5	2
α-helix	532-553	22
α-helix	559-587	29
α-helix	594-629	36
α-helix	632-635	4
α-helix	636-640	5
α-helix	645-654	10
α-helix	659-667	9

Chain C: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	436-448	13	3
β-strand	454-456	3	3
β-strand	463-470	8	3
β-strand	473-477	5	3
α-helix	489-491	3
β-strand	493-496	4	3
β-strand	501-504	4	3
β-strand	514-518	5	3
β-strand	524-528	5	3
α-helix	532-553	22
α-helix	559-587	29
α-helix	594-629	36
α-helix	632-635	4
α-helix	636-640	5
α-helix	645-654	10
α-helix	659-667	9

Chain D: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	436-448	13	4
β-strand	454-456	3	4
β-strand	463-470	8	4
β-strand	473-477	5	4
β-strand	493-496	4	4
β-strand	501-504	4	4
β-strand	514-518	5	4
β-strand	524-528	5	4
α-helix	532-554	23
α-helix	559-587	29
α-helix	594-628	35
α-helix	632-635	4
α-helix	636-640	5
α-helix	645-654	10
α-helix	659-667	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-lymphoma invasion and metastasis-inducing protein 1	A, B, C, D	protein	276	Homo sapiens	Q13009 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4K2P_1 T-lymphoma invasion and metastasis-inducing protein 1 (chains A, B, C, D)
GSAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDGRSGID
HNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIHSAC
ATAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKLKKMGELQLSSVTDSKAAATILDQIFV
WEQNLEQFQMDLFRFRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALV
AARTGETGVRRRTQAMSRSASKRRSRFSSLWGLDTT

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	5

Primary citation

High-resolution structure of the Tiam1 PHn-CC-Ex domain. Joshi, M., Gakhar, L., Fuentes, E.J. Acta Crystallogr Sect F Struct Biol Cryst Commun (2013) 69:744-752. DOI 10.1107/S1744309113014206 · PubMed

Other PDB entries of the same protein (UniProt Q13009 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KZD 1.3 Å, Crystal Structure of Free T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain
4GVC 1.54 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in complex with…
3KZE 1.8 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in Complex With…
4GVD 1.85 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in complex with…
4NXR 1.9 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple…
4NXQ 2.1 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple…
4K2O 2.15 Å, The Structure of a Triple Mutant of the Tiam1 PH-CC-Ex Domain
4NXP 2.3 Å, Crystal Structure of Free T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple…
2D8I Solution structure of the PDZ domain of T-cell lymphoma invasion and metastasis 1 varian

Browse structure collections

About this viewer

MolViewer shows 4K2P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.