4N75: BamA-mediate Outer Membrane Protein Biogenesis

Name: PDB 4N75: Structural Basis of BamA-mediate Outer Membrane Protein Biogenesis
Published: 2014-04-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Structural Basis of BamA-mediate Outer Membrane Protein Biogenesis. Determined by X-ray diffraction at 2.6 Å resolution. Released 16 Apr 2014.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Escherichia coli
Chains: 2
Atoms: 5,890
Mol. weight: 86.07 kDa
Released: 16 Apr 2014

Explore 4N75 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4N75 contains 15 α-helices and 55 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	427-433	7	1
β-strand	437-446	10	1
β-strand	455-462	8	1
β-strand	466-475	10	1
β-strand	484-495	12	1
α-helix	496-499	4
β-strand	501	1	2
β-strand	505-520	16	1
β-strand	523-537	15	1
α-helix	539-541	3
β-strand	542	1	3
α-helix	543-551	9
β-strand	564-579	16	1
β-strand	590-600	11	1
β-strand	608-620	13	1
β-strand	628-640	13	1
α-helix	644-647	4
α-helix	648-650	3
β-strand	652	1	4
β-strand	654	1	5
β-strand	662-663	2	6
β-strand	668	1	5
β-strand	671	1	2
β-strand	674	1	3
α-helix	675-676	2
β-strand	700	1	3
β-strand	705	1	2
β-strand	708	1	4
β-strand	710-720	11	1
α-helix	721-722	2
β-strand	733-745	13	1
β-strand	767-778	12	1
β-strand	781-792	12	1
α-helix	797-798	2
β-strand	799-800	2	6
β-strand	802-809	8	1

Chain B: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	427-433	7	7
β-strand	437-446	10	7
β-strand	455-462	8	7
β-strand	466-475	10	7
β-strand	484-495	12	7
α-helix	497-499	3
β-strand	501	1	8
β-strand	505-520	16	7
β-strand	523-537	15	7
β-strand	542	1	8
α-helix	543-551	9
β-strand	564-579	16	7
β-strand	590-600	11	7
β-strand	608-620	13	7
β-strand	628-640	13	7
α-helix	645-647	3
α-helix	648-650	3
β-strand	652	1	9
β-strand	654	1	10
β-strand	662-663	2	11
β-strand	668	1	10
β-strand	671-674	4	8
α-helix	675-676	2
β-strand	700-705	6	8
β-strand	708	1	9
β-strand	710-720	11	7
α-helix	721-722	2
β-strand	730	1	7
β-strand	733-745	13	7
β-strand	767-778	12	7
β-strand	781-792	12	7
α-helix	797-798	2
β-strand	799-800	2	11
β-strand	802-809	8	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Outer membrane protein assembly factor BamA	A, B	protein	385	Escherichia coli	P0A940 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4N75_1 Outer membrane protein assembly factor BamA (chains A, B)
MNFGIGYGTESGVSFQAGVQQDNWLGTGYAVGINGTKNDYQTYAELSVTNPYFTVDGVSL
GGRLFYNDFQADDADLSDYTNKSYGTDVTLGFPINEYNSLRAGLGYVHNSLSNMQPQVAM
WRYLYSMGEHPSTSDQDNSFKTDDFTFNYGWTYNKLDRGYFPTDGSRVNLTGKVTIPGSD
NEYYKVTLDTATYVPIDDDHKWVVLGRTRWGYGDGLGGKEMPFYENFYAGGSSTVRGFQS
NTIGPKAVYFPHQASNYDPDYDYECATQDGAKDLCKSDDAVGGNAMAVASLEFITPTPFI
SDKYANSVRTSFFWDMGTVWDTNWDSSQYSGYPDYSDPSNIRMSAGIALQWMSPLGPLVF
SYAQPFKKYDGDKAEQFQFNIGKTW

Primary citation

Structural and functional analysis of the beta-barrel domain of BamA from Escherichia coli. Ni, D., Wang, Y., Yang, X. et al. FASEB J (2014) 28:2677-2685. DOI 10.1096/fj.13-248450 · PubMed

Other PDB entries of the same protein (UniProt P0A940 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3Q6B 1.5 Å, The high-resolution and new form crystal structure of BamA POTRA4-5 from E.coli
9CS2 1.78 Å, E. coli BamA beta-barrel bound to cyclic peptide CP3
6QGW 1.94 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody E6
9CS0 1.94 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP1
9CS1 2.15 Å, E. coli BamA beta-barrel bound to darobactin and cyclic peptide CP2
4XGA 2.15 Å, Crystal structure of BamB and BamA P3-5 complex from E.coli
2QDF 2.2 Å, Structure of N-terminal domain of E. Coli YaeT
6QGX 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with nanobody F7
7NRF 2.2 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 2)
7NRE 2.3 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin (crystal form 1)
7P1C 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with darobactin B
7R1V 2.5 Å, Crystal structure of E.coli BamA beta-barrel in complex with dynobactin A

Browse structure collections

About this viewer

MolViewer shows 4N75 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.