4NAA: Ultraviolet-B receptor UVR8

Crystal structure of UVB photoreceptor UVR8 from Arabidopsis thaliana and UV-induced structural changes at 120K. Determined by X-ray diffraction at 1.67 Å resolution. Released 26 Oct 2016.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: Arabidopsis thaliana
Chains: 4
Atoms: 12,991
Mol. weight: 163.65 kDa
Ligands: MG
Released: 26 Oct 2016

Explore 4NAA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NAA contains 40 α-helices and 112 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	17-22	6	1
β-strand	26-31	6	1
β-strand	35-40	6	1
β-strand	55-60	6	1
α-helix	62-64	3
β-strand	69-74	6	2
β-strand	78-83	6	2
β-strand	88-93	6	2
α-helix	96-98	3
β-strand	108-113	6	2
α-helix	115-117	3
β-strand	122-127	6	3
β-strand	131-136	6	3
β-strand	141-145	5	3
β-strand	160-165	6	3
α-helix	167-169	3
β-strand	174-179	6	4
β-strand	183-188	6	4
β-strand	193-197	5	4
β-strand	212-217	6	4
α-helix	224-225	2
β-strand	226-231	6	5
β-strand	235-240	6	5
β-strand	245-249	5	5
β-strand	264-269	6	5
α-helix	271-273	3
β-strand	278-283	6	6
β-strand	287-292	6	6
β-strand	297-301	5	6
β-strand	316-322	7	6
α-helix	323	1
α-helix	325-327	3
α-helix	328-329	2
β-strand	330-335	6	7
β-strand	339-344	6	7
β-strand	349-353	5	7
β-strand	368-373	6	7
α-helix	375-377	3

Chain B: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
β-strand	17-22	6	8
β-strand	26-31	6	8
β-strand	35-40	6	8
β-strand	55-60	6	8
α-helix	62-64	3
β-strand	69-74	6	9
β-strand	78-83	6	9
β-strand	88-93	6	9
α-helix	96-98	3
β-strand	108-113	6	9
α-helix	115-117	3
β-strand	122-127	6	10
β-strand	131-136	6	10
β-strand	141-145	5	10
β-strand	160-165	6	10
α-helix	167-169	3
β-strand	174-179	6	11
β-strand	183-188	6	11
β-strand	193-197	5	11
β-strand	212-217	6	11
β-strand	226-231	6	12
β-strand	235-240	6	12
β-strand	245-249	5	12
β-strand	264-269	6	12
α-helix	271-273	3
β-strand	278-283	6	13
β-strand	287-292	6	13
β-strand	297-301	5	13
β-strand	316-322	7	13
α-helix	323	1
α-helix	325-327	3
α-helix	328-329	2
β-strand	330-335	6	14
β-strand	339-344	6	14
β-strand	349-353	5	14
β-strand	368-373	6	14
α-helix	375-377	3

Chain C: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	17-22	6	15
β-strand	26-31	6	15
β-strand	35-40	6	15
β-strand	55-60	6	15
α-helix	62-64	3
β-strand	69-74	6	16
β-strand	78-83	6	16
β-strand	88-93	6	16
α-helix	96-98	3
β-strand	108-113	6	16
α-helix	115-117	3
α-helix	120-121	2
β-strand	122-127	6	17
β-strand	131-136	6	17
β-strand	141-145	5	17
β-strand	160-165	6	17
α-helix	167-169	3
β-strand	174-179	6	18
β-strand	183-188	6	18
β-strand	193-197	5	18
β-strand	212-217	6	18
β-strand	226-231	6	19
β-strand	235-240	6	19
β-strand	245-249	5	19
β-strand	264-269	6	19
α-helix	271-273	3
β-strand	278-283	6	20
β-strand	287-292	6	20
β-strand	297-301	5	20
β-strand	316-322	7	20
α-helix	323	1
α-helix	325-327	3
α-helix	328-329	2
β-strand	330-335	6	21
β-strand	339-344	6	21
β-strand	349-353	5	21
β-strand	368-373	6	21
α-helix	375-377	3

Chain D: 10 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	14-16	3
β-strand	17-22	6	22
β-strand	26-31	6	22
β-strand	35-40	6	22
β-strand	55-60	6	22
α-helix	62-64	3
β-strand	71-74	4	23
β-strand	78-83	6	23
β-strand	88-93	6	23
α-helix	96-98	3
β-strand	108-113	6	23
α-helix	115-117	3
β-strand	122-127	6	24
β-strand	131-136	6	24
β-strand	141-145	5	24
β-strand	160-165	6	24
α-helix	167-169	3
β-strand	174-179	6	25
β-strand	183-188	6	25
β-strand	193-197	5	25
β-strand	212-217	6	25
β-strand	226-231	6	26
β-strand	235-240	6	26
β-strand	245-249	5	26
β-strand	264-269	6	26
α-helix	271-273	3
β-strand	278-283	6	27
β-strand	287-292	6	27
β-strand	297-301	5	27
β-strand	316-322	7	27
α-helix	323	1
α-helix	325-327	3
α-helix	328-329	2
β-strand	330-335	6	28
β-strand	339-344	6	28
β-strand	349-353	5	28
β-strand	368-373	6	28
α-helix	375-377	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ultraviolet-B receptor UVR8	A, B, C, D	protein	377	Arabidopsis thaliana	Q9FN03 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>4NAA_1 Ultraviolet-B receptor UVR8 (chains A, B, C, D)
PPRKVLIISAGASHSVALLSGDIVCSWGRGEDGQLGHGDAEDRPSPTQLSALDGHQIVSV
TCGADHTVAYSQSGMEVYSWGWGDFGRLGHGNSSDLFTPLPIKALHGIRIKQIACGDSHC
LAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVTEDGD
LYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGALYTYGWSK
YGQLGHGDLEDHLIPHKLEALSNSFISQISGGWRHTMALTSDGKLYGWGWNKFGQVGVGN
NLDQCSPVQVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQLGIGESVDRNFPK
IIEALSVDGLEHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	6

Primary citation

Dynamic Crystallography Reveals Early Signalling Events in Ultraviolet Photoreceptor UVR8. Zeng, X., Ren, Z., Wu, Q. et al. Nat Plants (2015) 1. DOI 10.1038/nplants.2014.6 · PubMed

Other PDB entries of the same protein (UniProt Q9FN03 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6QTS 1.11 Å, Crystal structure of a mutant Arabidopsis WD40 domain in complex with a photoreceptor
6QTQ 1.3 Å, Crystal structure of an Arabidopsis WD40 domain in complex with photoreceptor
6XZL 1.39 Å, Arabidopsis UV-B photoreceptor UVR8 mutant D96N D107N
4NBM 1.61 Å, Crystal structure of UVB photoreceptor UVR8 and light-induced structural changes at 180K
4D9S 1.7 Å, Crystal structure of Arabidopsis thaliana UVR8 (UV Resistance locus 8)
4NC4 1.75 Å, Crystal structure of photoreceptor AtUVR8 mutant W285F and light-induced structural…
6XZN 1.75 Å, Arabidopsis UV-B photoreceptor UVR8 mutant G101S W285A
4DNU 1.76 Å, Crystal structure of the W285A mutant of UVB-resistance protein UVR8
4DNW 1.77 Å, Crystal structure of UVB-resistance protein UVR8
4DNV 2.0 Å, Crystal structure of the W285F mutant of UVB-resistance protein UVR8
6DD7 2.0 Å, Crystal structure of plant UVB photoreceptor UVR8 from in situ serial Laue diffraction
8GQE 2.0 Å, Crystal structure of the W285A mutant of UVR8 in complex with RUP2

Browse structure collections

About this viewer

MolViewer shows 4NAA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.