Arabidopsis UV-B photoreceptor UVR8 mutant G101S W285A. Determined by X-ray diffraction at 1.75 Å resolution. Released 13 Jan 2021.
Explore 6XZN in 3D Show helices and sheets RCSB PDB PDBe
6XZN contains 14 α-helices and 56 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-22 | 6 | 1 |
| β-strand | 26-31 | 6 | 1 |
| β-strand | 35-40 | 6 | 1 |
| β-strand | 55-60 | 6 | 1 |
| α-helix | 62-64 | 3 | |
| β-strand | 69-74 | 6 | 2 |
| β-strand | 78-83 | 6 | 2 |
| β-strand | 88-93 | 6 | 2 |
| β-strand | 108-113 | 6 | 2 |
| α-helix | 115-117 | 3 | |
| β-strand | 122-127 | 6 | 3 |
| β-strand | 131-136 | 6 | 3 |
| β-strand | 141-145 | 5 | 3 |
| β-strand | 160-165 | 6 | 3 |
| α-helix | 167-169 | 3 | |
| β-strand | 174-179 | 6 | 4 |
| β-strand | 183-188 | 6 | 4 |
| β-strand | 193-197 | 5 | 4 |
| β-strand | 212-218 | 7 | 4 |
| β-strand | 226-231 | 6 | 5 |
| β-strand | 235-240 | 6 | 5 |
| β-strand | 245-249 | 5 | 5 |
| β-strand | 264-269 | 6 | 5 |
| α-helix | 271-273 | 3 | |
| β-strand | 278-283 | 6 | 6 |
| β-strand | 287-292 | 6 | 6 |
| β-strand | 297-301 | 5 | 6 |
| β-strand | 316-322 | 7 | 6 |
| α-helix | 325-327 | 3 | |
| α-helix | 328-329 | 2 | |
| β-strand | 330-335 | 6 | 7 |
| β-strand | 339-344 | 6 | 7 |
| β-strand | 349-353 | 5 | 7 |
| β-strand | 368-373 | 6 | 7 |
| α-helix | 375-377 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17-22 | 6 | 8 |
| β-strand | 26-31 | 6 | 8 |
| β-strand | 35-40 | 6 | 8 |
| β-strand | 55-60 | 6 | 8 |
| α-helix | 62-64 | 3 | |
| β-strand | 69-74 | 6 | 9 |
| β-strand | 78-83 | 6 | 9 |
| β-strand | 88-93 | 6 | 9 |
| β-strand | 112-113 | 2 | 9 |
| α-helix | 115-117 | 3 | |
| β-strand | 122-127 | 6 | 10 |
| β-strand | 131-136 | 6 | 10 |
| β-strand | 141-145 | 5 | 10 |
| β-strand | 160-165 | 6 | 10 |
| α-helix | 167-169 | 3 | |
| β-strand | 174-179 | 6 | 11 |
| β-strand | 183-188 | 6 | 11 |
| β-strand | 193-197 | 5 | 11 |
| β-strand | 212-217 | 6 | 11 |
| β-strand | 226-231 | 6 | 12 |
| β-strand | 235-240 | 6 | 12 |
| β-strand | 245-249 | 5 | 12 |
| β-strand | 264-269 | 6 | 12 |
| α-helix | 271-273 | 3 | |
| β-strand | 278-283 | 6 | 13 |
| β-strand | 287-292 | 6 | 13 |
| β-strand | 297-301 | 5 | 13 |
| β-strand | 316-322 | 7 | 13 |
| α-helix | 325-327 | 3 | |
| α-helix | 328-329 | 2 | |
| β-strand | 330-335 | 6 | 14 |
| β-strand | 339-344 | 6 | 14 |
| β-strand | 349-353 | 5 | 14 |
| β-strand | 368-373 | 6 | 14 |
| α-helix | 375-377 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ultraviolet-B receptor UVR8 | A, B | protein | 373 | Arabidopsis thaliana | Q9FN03 (AlphaFold model) |
>6XZN_1 Ultraviolet-B receptor UVR8 (chains A, B) GAMAPPRKVLIISAGASHSVALLSGDIVCSWGRGEDGQLGHGDAEDRPSPTQLSALDGHQ IVSVTCGADHTVAYSQSGMEVYSWGWGDFGRLSHGNSSDLFTPLPIKALHGIRIKQIACG DSHCLAVTMEGEVQSWGRNQNGQLGLGDTEDSLVPQKIQAFEGIRIKMVAAGAEHTAAVT EDGDLYGWGWGRYGNLGLGDRTDRLVPERVTSTGGEKMSMVACGWRHTISVSYSGALYTY GWSKYGQLGHGDLEDHLIPHKLEALSNSFISQISGGARHTMALTSDGKLYGWGWNKFGQV GVGNNLDQCSPVQVRFPDDQKVVQVSCGWRHTLAVTERNNVFAWGRGTNGQLGIGESVDR NFPKIIEALSVDG
A constitutively monomeric UVR8 photoreceptor confers enhanced UV-B photomorphogenesis. Podolec, R., Lau, K., Wagnon, T.B. et al. Proc Natl Acad Sci U S A (2021) 118. DOI 10.1073/pnas.2017284118 · PubMed
Other PDB entries of the same protein (UniProt Q9FN03 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 6XZN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.