4NE1: Human MHF1 MHF2 DNA complexes
Human MHF1 MHF2 DNA complexes. Determined by X-ray diffraction at 6.5 Å resolution. Released 22 Jan 2014.
- Method
- X-ray diffraction
- Resolution
- 6.5 Å
- Organisms
- Synthetic DNA, Homo sapiens
- Chains
- 48
- Atoms
- 31,827
- Mol. weight
- 473.66 kDa
- Released
- 22 Jan 2014
Explore 4NE1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
4NE1 contains 151 α-helices and 70 β-strands across 40 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain a: 6 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 15-38 | 24 | |
| α-helix | 41 | 1 | |
| β-strand | 42 | 1 | 2 |
| α-helix | 43 | 1 | |
| α-helix | 44-71 | 28 | |
| β-strand | 76-77 | 2 | 3 |
| α-helix | 79-85 | 7 | |
| α-helix | 90-105 | 16 | |
Chain A: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 15-37 | 23 | |
| β-strand | 42 | 1 | 15 |
| α-helix | 44-71 | 28 | |
| β-strand | 76-77 | 2 | 16 |
| α-helix | 79-85 | 7 | |
| α-helix | 90-104 | 15 | |
Chains b, h, p, q, V and W: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-20 | 9 | |
| β-strand | 29-30 | 2 | 3 |
| α-helix | 32-59 | 28 | |
| β-strand | 65 | 1 | 2 |
| α-helix | 67-80 | 14 | |
Chains B and r: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-20 | 9 | |
| β-strand | 29-30 | 2 | 16 |
| α-helix | 32-59 | 28 | |
| β-strand | 65 | 1 | 15 |
| α-helix | 67-79 | 13 | |
Chain c: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 15-38 | 24 | |
| β-strand | 42 | 1 | 4 |
| α-helix | 44-71 | 28 | |
| β-strand | 77 | 1 | 5 |
| α-helix | 79-85 | 7 | |
| α-helix | 90-104 | 15 | |
Chain C: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 15-37 | 23 | |
| β-strand | 42 | 1 | 6 |
| α-helix | 44-71 | 28 | |
| β-strand | 76-77 | 2 | 7 |
| α-helix | 79-84 | 6 | |
| α-helix | 90-105 | 16 | |
Chain d: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-20 | 9 | |
| β-strand | 30 | 1 | 5 |
| α-helix | 32-60 | 29 | |
| β-strand | 65 | 1 | 4 |
| α-helix | 67-80 | 14 | |
Chain D: 3 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-21 | 10 | |
| β-strand | 29-30 | 2 | 7 |
| α-helix | 32-59 | 28 | |
| β-strand | 65 | 1 | 6 |
| α-helix | 67-80 | 14 | |
22 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| DNA (26-mer) | E, O, s, u | DNA | 26 | Synthetic DNA | |
| DNA (26-mer) | F, P, t, v | DNA | 26 | Synthetic DNA | |
| Centromere protein S | A, C, G, I, J, K, Q, R, S, T, Y, a, c, e, f, g, k, l, m, n | protein | 105 | Homo sapiens | Q8N2Z9 (AlphaFold model) |
| Centromere protein X | B, D, H, L, M, N, U, V, W, X, Z, b, d, h, i, j, o, p, q, r | protein | 74 | Homo sapiens | A8MT69 (AlphaFold model) |
Sequence of entity 1 (E, O, s, u), FASTA
>4NE1_1 DNA (26-MER) (chains E, O, s, u)
AAAAAAAAAAAAAAAAAAAAAAAAAA
Sequence of entity 2 (F, P, t, v), FASTA
>4NE1_2 DNA (26-MER) (chains F, P, t, v)
TTTTTTTTTTTTTTTTTTTTTTTTTT
Sequence of entity 3 (A, C, G, I, J, K, Q, R, S, T, Y, a, c, e, f, g, k, l, m, n), FASTA
>4NE1_3 Centromere protein S (chains A, C, G, I, J, K, Q, R, S, T, Y, a, c, e, f, g, k, l, m, n)
SYQQRLKAAVHYTVGCLCEEVALDKAMQFSKQTIAAISELTFRQCENFAKDLEMFARHAK
RTTINTEDVKLLARRSNSLLKYITDKSEEIAQANLERKAQKKKKS
Sequence of entity 4 (B, D, H, L, M, N, U, V, W, X, Z, b, d, h, i, j, o, p, q, r), FASTA
>4NE1_4 Centromere protein X (chains B, D, H, L, M, N, U, V, W, X, Z, b, d, h, i, j, o, p, q, r)
SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQAQAEDALRVDV
DQLEKVLPQLLLDF
Primary citation
The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes. Zhao, Q., Saro, D., Sachpatzidis, A. et al. Nat Commun (2014) 5:2987-2987. DOI 10.1038/ncomms3987 · PubMed
Other PDB entries of the same protein (UniProt Q8N2Z9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4NE3 1.8 Å, Human MHF1-MHF2 complex
- 4E45 2.0 Å, Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer in Complex with Fanconi…
- 4E44 2.1 Å, Crystal structure of the hMHF1/hMHF2 Histone-Fold Tetramer
- 4NE6 2.1 Å, Human MHF1-MHF2 complex
- 4DRA 2.41 Å, Crystal structure of MHF complex
- 4NE5 2.5 Å, Human MHF1-MHF2 complex
- 4DRB 2.63 Å, The crystal structure of FANCM bound MHF complex
- 28OP 2.7 Å, Structure of the human inner kinetochore CCAN and CENP-C bound to DNA
- 7R5S 2.83 Å, Structure of the human CCAN bound to alpha satellite DNA
- 7XHO 3.29 Å, Structure of human inner kinetochore CCAN complex
- 9TAW 3.54 Å, Structure of the human inner kinetochore CCAN bound to DNA
- 7XHN 3.71 Å, Structure of human inner kinetochore CCAN-DNA complex
Browse structure collections
About this viewer
MolViewer shows 4NE1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.