4NXQ: PDB entry 4NXQ

Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple Mutant (QM) in Complex With Caspr4 Peptide. Determined by X-ray diffraction at 2.1 Å resolution. Released 13 May 2015.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 6
Atoms: 2,439
Mol. weight: 33.89 kDa
Released: 13 May 2015

Explore 4NXQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4NXQ contains 12 α-helices and 21 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	842-849	8	1
α-helix	850-852	3
β-strand	860-867	8	1
β-strand	870-878	9	1
α-helix	883-886	4
β-strand	894-898	5	1
β-strand	901-902	2	1
α-helix	903-905	3
α-helix	908-916	9
β-strand	919-926	8	1

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	4-7	4	1

Chains E and F: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	5-7	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-lymphoma invasion and metastasis-inducing protein 1	A, B, C	protein	94	Homo sapiens	Q13009 (AlphaFold model)
Contactin-associated protein-like 4 peptide	D, E, F	protein	8	Homo sapiens	Q9C0A0 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>4NXQ_1 T-lymphoma invasion and metastasis-inducing protein 1 (chains A, B, C)
GAMGKVTHSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEIL
EINNRAADALNSSMMEDFFSQPSVGLLVRTYPEL

Sequence of entity 2 (D, E, F), FASTA

>4NXQ_2 Contactin-associated protein-like 4 peptide (chains D, E, F)
ENQKEYFF

Primary citation

Distinct Roles for Conformational Dynamics in Protein-Ligand Interactions. Liu, X., Speckhard, D.C., Shepherd, T.R. et al. Structure (2016) 24:2053-2066. DOI 10.1016/j.str.2016.08.019 · PubMed

Other PDB entries of the same protein (UniProt Q13009 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KZD 1.3 Å, Crystal Structure of Free T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain
4GVC 1.54 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in complex with…
3KZE 1.8 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in Complex With…
4GVD 1.85 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ in complex with…
4NXR 1.9 Å, Crystal Structure of T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple…
4K2P 1.98 Å, The Structure of a Quintuple Mutant of the Tiam1 PH-CC-Ex Domain
4K2O 2.15 Å, The Structure of a Triple Mutant of the Tiam1 PH-CC-Ex Domain
4NXP 2.3 Å, Crystal Structure of Free T-cell Lymphoma Invasion and Metastasis-1 PDZ Domain Quadruple…
2D8I Solution structure of the PDZ domain of T-cell lymphoma invasion and metastasis 1 varian

Browse structure collections

About this viewer

MolViewer shows 4NXQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.