4ONS: Catenin alpha-2

Structural and thermodynamic characterization of cadherin-beta-catenin-alpha-catenin complex formation. Determined by X-ray diffraction at 2.8 Å resolution. Released 9 Apr 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 4
Atoms: 4,318
Mol. weight: 74.53 kDa
Released: 9 Apr 2014

Explore 4ONS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ONS contains 23 α-helices and 2 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	22-35	14
α-helix	55-81	27
α-helix	86-112	27
α-helix	117-164	48
α-helix	169-196	28
α-helix	200-228	29
α-helix	234-258	25

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	85-88	4
α-helix	90-98	9
α-helix	100-102	3
α-helix	121-140	20

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	22-35	14
α-helix	55-81	27
α-helix	86-112	27
α-helix	117-163	47
α-helix	175-184	10
α-helix	189-194	6
α-helix	208-227	20
α-helix	238-257	20

Chain D: 4 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	85-88	4
α-helix	90-98	9
α-helix	100-102	3
β-strand	115	1	1
β-strand	118	1	1
α-helix	121-140	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Catenin alpha-2	A, C	protein	248	Mus musculus	Q61301 (AlphaFold model)
Catenin beta-1	B, D	protein	88	Mus musculus	Q02248 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>4ONS_1 Catenin alpha-2 (chains A, C)
MEIRTLTVERLLEPLVTQVTTLVNTSNKGPSGKKKGRSKKAHVLAASVEQATQNFLEKGE
QIAKESQDLKEELVAAVEDVRKQGETMRIASSEFADDPCSSVKRGTMVRAARALLSAVTR
LLILADMADVMRLLSHLKIVEEALEAVKNATNEQDLANRFKEFGKEMVKLNYVAARRQQE
LKDPHCRDEMAAARGALKKNATMLYTASQAFLRHPDVAATRANRDYVFKQVQEAIAGISS
AAQATSPT

Sequence of entity 2 (B, D), FASTA

>4ONS_2 Catenin beta-1 (chains B, D)
MGSSHHHHHHSQDPQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQ
RLAEPSQMLKHAVVNLINYQDDAELATR

Primary citation

Structural and Thermodynamic Characterization of Cadherin beta-Catenin alpha-Catenin Complex Formation. Pokutta, S., Choi, H.J., Ahlsen, G. et al. J Biol Chem (2014) 289:13589-13601. DOI 10.1074/jbc.M114.554709 · PubMed

Other PDB entries of the same protein (UniProt Q61301 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XFL 2.45 Å, Crystal structure of the force-sensing device region of alpha N-catenin
4P9T 2.5 Å, Structure of the free form of the N-terminal VH1 domain of monomeric alpha-catenin
4K1O 2.6 Å, Crystal structure of the alphaN-catenin actin-binding domain
6DUY 2.81 Å, Crystal structure of the alpha-N-catenin actin-binding domain H1 mutant

Browse structure collections

About this viewer

MolViewer shows 4ONS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.