4PS4: Complex between IL-13 and M1295 FAB

Crystal structure of the complex between IL-13 and M1295 FAB. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Mar 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,931
Mol. weight: 60.39 kDa
Released: 19 Mar 2014

Explore 4PS4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4PS4 contains 20 α-helices and 44 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	8-19	12
α-helix	44-51	8
α-helix	61-67	7
α-helix	92-109	18

Chain H: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	6
α-helix	7-9	3
β-strand	10-12	3	7
β-strand	18-25	8	6
β-strand	35-41	7	7
β-strand	48-54	7	7
β-strand	59-61	3	7
β-strand	69-74	6	6
β-strand	79-84	6	6
α-helix	89-91	3
β-strand	93-100	8	7
β-strand	108-111	4	7
β-strand	115-119	5	7
α-helix	123-124	2
β-strand	125	1	8
α-helix	126-127	2
β-strand	128-132	5	9
β-strand	143-153	11	9
β-strand	154	1	8
β-strand	159-162	4	10
α-helix	163-165	3
β-strand	167	1	10
β-strand	171-173	3	9
α-helix	174-176	3
β-strand	177-178	2	9
β-strand	184-193	10	9
α-helix	194-196	3
β-strand	203-208	6	10
α-helix	209-211	3
β-strand	213-218	6	10

Chain L: 8 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
α-helix	18	1
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-65	4	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
β-strand	97	1	2
β-strand	101-105	5	2
β-strand	110	1	3
α-helix	111-112	2
β-strand	113-117	5	4
α-helix	118-120	3
α-helix	121-124	4
β-strand	128-138	11	4
β-strand	139	1	3
β-strand	143-149	7	5
β-strand	152-154	3	5
β-strand	158-162	5	4
α-helix	163-166	4
β-strand	172-181	10	4
α-helix	182-186	5
β-strand	190-197	8	5
β-strand	204-209	6	5
β-strand	212	1	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
M1295 light chain	L	protein	213	Homo sapiens
M1295 heavy chain	H	protein	228	Homo sapiens
Interleukin-13	A	protein	113	Homo sapiens	P35225 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>4PS4_1 M1295 LIGHT CHAIN (chains L)
EIVLTQSPATLSLSPGERATLSCRASKSISKYLAWYQQKPGQAPRLLIYSGSTLQSGIPA
RFSGSGSGTDFTLTISSLEPEDFAVYYCQQHDYPYTFGQGTKLEIKRTVAAPSVFIFPPS
DEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTL
SKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>4PS4_2 M1295 HEAVY CHAIN (chains H)
QVTLKESGPVLVKPTETLTLTCTVSGFSLSTYGVGVGWIRQPPGKALEWLAHIWWDDVKR
YNPALKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARLGSDYDVWFDYWGQGTLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTH

Sequence of entity 3 (A), FASTA

>4PS4_3 Interleukin-13 (chains A)
MGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAI
EKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Primary citation

Human Framework Adaptation of a Mouse Anti-Human Il-13 Antibody. Fransson, J., Teplyakov, A., Raghunathan, G. et al. J Mol Biol (2010) 398:214. DOI 10.1016/J.JMB.2010.03.004 · PubMed

Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5X 1.9 Å, Crystal structure of the complex between IL-13 and H2L6 FAB
4I77 1.9 Å, Lebrikizumab Fab bound to IL-13
5L6Y 1.99 Å, il13 in complex with tralokinumab
3L5W 2.0 Å, Crystal structure of the complex between IL-13 and C836 FAB
3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3LB6 3.05 Å, The structure of IL-13 in complex with IL-13Ralpha2
3G6D 3.2 Å, Crystal structure of the complex between CNTO607 Fab and IL-13
8BLQ 3.97 Å, Cryo-EM structure of the CODV-IL13-RefAb triple complex
1GA3 NMR structure of interleukin-13
1IJZ Solution Structure of Human IL-13
1IK0 Solution Structure of Human IL-13

Browse structure collections

About this viewer

MolViewer shows 4PS4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.