4RAX: A regulatory domain of an ion channel

A regulatory domain of an ion channel. Determined by X-ray diffraction at 1.45 Å resolution. Released 23 Sept 2015.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Mus musculus
Chains: 1
Atoms: 2,159
Mol. weight: 28.35 kDa
Released: 23 Sept 2015

Explore 4RAX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4RAX contains 10 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 10 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	2219	1	1
β-strand	2225-2232	8	2
α-helix	2236-2237	2
β-strand	2239-2243	5	2
β-strand	2248-2250	3	3
α-helix	2251-2252	2
α-helix	2253-2263	11
α-helix	2267-2273	7
α-helix	2278-2280	3
β-strand	2281-2287	7	3
β-strand	2289	1	4
α-helix	2298-2310	13
β-strand	2315-2324	10	2
α-helix	2327-2329	3
β-strand	2335-2344	10	2
α-helix	2349-2357	9
β-strand	2366-2372	7	4
β-strand	2375-2378	4	3
β-strand	2383	1	2
β-strand	2386	1	3
α-helix	2394-2397	4
β-strand	2399-2409	11	4
β-strand	2426-2434	9	4
β-strand	2443-2450	8	3
β-strand	2453	1	1
α-helix	2454-2456	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Piezo-type mechanosensitive ion channel component 1	A	protein	252	Mus musculus	E2JF22 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4RAX_1 Piezo-type mechanosensitive ion channel component 1 (chains A)
RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPFTPQAYEELSQQFDPYPLAMQFI
SQYSPEDIVTAQIEGSSGALWRISPPSRAQMKQELYNGTADITLRFTWNFQRDLAKGGTV
EYTNEKHTLELAPNSTARRQLAQLLEGRPDQSVVIPHLFPKYIRAPNGPEANPVKQLQPD
EEEDYLGVRIQLRREQVGTGASGEQAGTKASDFLEWWVIELQDCKADCNLLPMVIFSDKV
SPPSVEHHHHHH

Primary citation

Architecture of the mammalian mechanosensitive Piezo1 channel. Ge, J., Li, W., Zhao, Q. et al. Nature (2015) 527:64-69. DOI 10.1038/nature15247 · PubMed

Other PDB entries of the same protein (UniProt E2JF22 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WLT 3.46 Å, the Curved Structure of mPIEZO1 in Lipid Bilayer
9VED 3.63 Å, The cryo-EM structure of mouse Piezo1-MDFI complex
8IMZ 3.66 Å, Cryo-EM structure of mouse Piezo1-MDFIC complex (composite map)
11YE 3.7 Å, Curved structure of mPiezo1 in plasma membrane vesicles
6B3R 3.8 Å, Structure of the mechanosensitive channel Piezo1
6BPZ 3.8 Å, Structure of the mechanically activated ion channel Piezo1
5Z10 3.97 Å, Structure of the mechanosensitive Piezo1 channel
8IXO 4.0 Å, Intermediate structure of mPIEZO1-S2472E
8IXN 4.07 Å, Curved structure of mPIEZO1-S2472E
6LQI 4.5 Å, Cryo-EM structure of the mouse Piezo1 isoform Piezo1.1
3JAC 4.8 Å, Cryo-EM study of a channel
11ZC 6.0 Å, Flat structure of mPiezo1 in plasma membrane vesicles

Browse structure collections

About this viewer

MolViewer shows 4RAX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.