Crystal structure of Rsa4 from Chaetomium thermophilum. Determined by X-ray diffraction at 1.8 Å resolution. Released 19 Nov 2014.
Explore 4WJS in 3D Show helices and sheets RCSB PDB PDBe
4WJS contains 13 α-helices and 43 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 36-42 | 7 | 1 |
| β-strand | 48 | 1 | 1 |
| β-strand | 53-56 | 4 | 1 |
| α-helix | 57-59 | 3 | |
| α-helix | 62-72 | 11 | |
| α-helix | 77-79 | 3 | |
| α-helix | 80-82 | 3 | |
| β-strand | 83-88 | 6 | 1 |
| β-strand | 95-96 | 2 | 1 |
| α-helix | 99-100 | 2 | |
| α-helix | 103-109 | 7 | |
| α-helix | 119 | 1 | |
| β-strand | 120-126 | 7 | 1 |
| α-helix | 132-135 | 4 | |
| β-strand | 137-142 | 6 | 2 |
| β-strand | 149-154 | 6 | 3 |
| β-strand | 161-166 | 6 | 3 |
| β-strand | 171-175 | 5 | 3 |
| β-strand | 180-185 | 6 | 3 |
| β-strand | 192-197 | 6 | 4 |
| β-strand | 204-208 | 5 | 4 |
| β-strand | 213-217 | 5 | 4 |
| β-strand | 222-223 | 2 | 4 |
| β-strand | 228 | 1 | 4 |
| β-strand | 235-240 | 6 | 5 |
| α-helix | 241-242 | 2 | |
| α-helix | 243-245 | 3 | |
| β-strand | 247 | 1 | 6 |
| β-strand | 250 | 1 | 6 |
| β-strand | 252-257 | 6 | 5 |
| β-strand | 262-266 | 5 | 5 |
| β-strand | 271-276 | 6 | 5 |
| β-strand | 283-288 | 6 | 7 |
| β-strand | 293-298 | 6 | 7 |
| β-strand | 303-307 | 5 | 7 |
| β-strand | 312-317 | 6 | 7 |
| β-strand | 324-329 | 6 | 8 |
| α-helix | 332-336 | 5 | |
| α-helix | 350-365 | 16 | |
| β-strand | 366-367 | 2 | 9 |
| β-strand | 370-371 | 2 | 9 |
| β-strand | 375-379 | 5 | 8 |
| β-strand | 384-387 | 4 | 8 |
| α-helix | 389-392 | 4 | |
| β-strand | 398-400 | 3 | 8 |
| β-strand | 407-412 | 6 | 10 |
| β-strand | 418-423 | 6 | 10 |
| β-strand | 428-432 | 5 | 10 |
| β-strand | 438-442 | 5 | 10 |
| β-strand | 449-454 | 6 | 11 |
| β-strand | 460-465 | 6 | 11 |
| β-strand | 470-474 | 5 | 11 |
| β-strand | 479-484 | 6 | 11 |
| β-strand | 491-496 | 6 | 2 |
| β-strand | 502-507 | 6 | 2 |
| β-strand | 512-516 | 5 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rsa4 | A | protein | 485 | Chaetomium thermophilum | G0SC29 (AlphaFold model) |
>4WJS_1 Rsa4 (chains A) DLGSFKANFIDSDGNQMTDVVEINFADATEKNISNLLNTLLGRDREEFTPYRFRIHIPGK DLIIDQYPNDLLSLLQKHGVTNPFETTITLSAEPQAIFKVHAVSRLAHRIPGHGQPILSC QFSPVSSSRLATGSGDNTARIWDTDSGTPKFTLKGHTGWVLGVSWSPDGKYLATCSMDTT VRVWDPESGKQVNQEFRGHAKWVLALAWQPYHLWRDGTARLASASKDCTVRIWLVNTGRT EHVLSGHKGSVSCVKWGGTDLIYTGSHDRSVRVWDAVKGTLVHNFTAHGHWVNHIALSSD HVLRTAYHDHTKEVPGTEEERRAKAKERFEKAAKIKGKVAERLVSASDDFTMYLWDPTNN GSKPVARLLGHQNKVNHVQFSPDGTLIASAGWDNSTKLWNARDGKFIKNLRGHVAPVYQC AWSADSRLVVTGSKDCTLKVWNVRTGKLAMDLPGHEDEVYAVDWAADGELVASGGKDKAV RTWRN
A network of assembly factors is involved in remodeling rRNA elements during preribosome maturation. Baler, J., Paternoga, H., Holdermann, I. et al. J Cell Biol (2014) 207:481-498. DOI 10.1083/jcb.201408111 · PubMed
Other PDB entries of the same protein (UniProt G0SC29 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4WJS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.