4WJU: Rsa4 from Saccharomyces cerevisiae

Crystal structure of Rsa4 from Saccharomyces cerevisiae. Determined by X-ray diffraction at 2.8 Å resolution. Released 19 Nov 2014.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c)
Chains: 2
Atoms: 7,061
Mol. weight: 114.31 kDa
Released: 19 Nov 2014

Explore 4WJU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WJU contains 22 α-helices and 83 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	34-38	5	1
β-strand	43	1	1
β-strand	49-50	2	1
α-helix	57-68	12
β-strand	77-80	4	1
α-helix	103-105	3
β-strand	117-123	7	1
α-helix	129-132	4
β-strand	134-135	2	2
α-helix	137-138	2
β-strand	139	1	2
α-helix	140	1
β-strand	146-151	6	3
β-strand	158-163	6	3
β-strand	168-172	5	3
β-strand	177-182	6	3
β-strand	189-194	6	4
β-strand	201-205	5	4
β-strand	210-213	4	4
β-strand	220	1	4
β-strand	225	1	4
β-strand	232-237	6	5
α-helix	238-239	2
α-helix	240-242	3
α-helix	244	1
β-strand	245	1	6
β-strand	247	1	6
β-strand	251-255	5	5
β-strand	260-264	5	5
β-strand	269-273	5	5
β-strand	281-286	6	7
β-strand	291-296	6	7
β-strand	301-305	5	7
α-helix	306-308	3
β-strand	311-316	6	7
β-strand	323-328	6	8
α-helix	331-336	6
α-helix	344-346	3
α-helix	349-364	16
β-strand	365	1	9
β-strand	370	1	9
β-strand	374-378	5	8
β-strand	383-386	4	8
β-strand	396-398	3	8
β-strand	405-410	6	10
β-strand	416-421	6	10
β-strand	426-430	5	10
β-strand	436-440	5	10
β-strand	447-452	6	11
β-strand	458-463	6	11
β-strand	467-472	6	11
β-strand	477-483	7	11
β-strand	489-494	6	2
β-strand	500-505	6	2
β-strand	510-514	5	2

Chain B: 10 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	34-38	5	12
α-helix	58-66	9
β-strand	77-79	3	12
α-helix	101-105	5
β-strand	117-123	7	12
α-helix	129-132	4
β-strand	134-140	7	13
β-strand	146-151	6	14
β-strand	158-163	6	14
β-strand	168-172	5	14
β-strand	177-182	6	14
β-strand	189-194	6	15
β-strand	201-205	5	15
β-strand	210-214	5	15
β-strand	219-220	2	15
β-strand	225	1	15
β-strand	232-237	6	16
α-helix	238-239	2
α-helix	240-242	3
α-helix	244	1
β-strand	245	1	17
β-strand	247	1	17
β-strand	251-255	5	16
β-strand	259-263	5	16
β-strand	270-275	6	16
β-strand	281-286	6	18
β-strand	291-296	6	18
β-strand	301-305	5	18
α-helix	306-308	3
β-strand	311-316	6	18
β-strand	323-328	6	19
α-helix	331-336	6
α-helix	344-346	3
α-helix	349-364	16
β-strand	365	1	20
β-strand	370	1	20
β-strand	374-378	5	19
β-strand	383-387	5	19
β-strand	391-396	6	19
β-strand	405-410	6	21
β-strand	416-421	6	21
β-strand	426-430	5	21
β-strand	436-440	5	21
β-strand	447-452	6	22
β-strand	458-463	6	22
β-strand	467-472	6	22
β-strand	477-483	7	22
β-strand	489-494	6	13
β-strand	500-505	6	13
β-strand	509-514	6	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ribosome assembly protein 4	A, B	protein	515	Saccharomyces cerevisiae (strain ATCC 204508 / S288c)	P25382 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>4WJU_1 Ribosome assembly protein 4 (chains A, B)
MSTLIPPPSKKQKKEAQLPREVAIIPKDLPNVSIKFQALDTGDNVGGALRVPGAISEKQL
EELLNQLNGTSDDPVPYTFSCTIQGKKASDPVKTIDITDNLYSSLIKPGYNSTEDQITLL
YTPRAVFKVKPVTRSSSAIAGHGSTILCSAFAPHTSSRMVTGAGDNTARIWDCDTQTPMH
TLKGHYNWVLCVSWSPDGEVIATGSMDNTIRLWDPKSGQCLGDALRGHSKWITSLSWEPI
HLVKPGSKPRLASSSKDGTIKIWDTVSRVCQYTMSGHTNSVSCVKWGGQGLLYSGSHDRT
VRVWDINSQGRCINILKSHAHWVNHLSLSTDYALRIGAFDHTGKKPSTPEEAQKKALENY
EKICKKNGNSEEMMVTASDDYTMFLWNPLKSTKPIARMTGHQKLVNHVAFSPDGRYIVSA
SFDNSIKLWDGRDGKFISTFRGHVASVYQVAWSSDCRLLVSCSKDTTLKVWDVRTRKLSV
DLPGHKDEVYTVDWSVDGKRVCSGGKDKMVRLWTH

Primary citation

A network of assembly factors is involved in remodeling rRNA elements during preribosome maturation. Baler, J., Paternoga, H., Holdermann, I. et al. J Cell Biol (2014) 207:481-498. DOI 10.1083/jcb.201408111 · PubMed

Other PDB entries of the same protein (UniProt P25382 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7UOO 2.34 Å, Nucleoplasmic pre-60S intermediate of the Nog2 containing pre-rotation state
7V08 2.36 Å, Nucleoplasmic pre-60S intermediate of the Nog2 containing pre-rotation state from a Spb1…
7UQB 2.43 Å, Nucleoplasmic pre-60S intermediate of the Nog2 containing pre-rotation state from a…
7UQZ 2.44 Å, Nucleoplasmic pre-60S intermediate of the Nog2 containing pre-rotation state from a SPB1…
7UG6 2.9 Å, Cryo-EM structure of pre-60S ribosomal subunit, unmethylated G2922
6YLG 3.0 Å, Rix1-Rea1 pre-60S particle - 60S core, body 1 (rigid body refinement)
3JCT 3.08 Å, Cryo-em structure of eukaryotic pre-60S ribosomal subunits
6YLH 3.1 Å, Rix1-Rea1 pre-60S particle - full composite structure
7OHQ 3.1 Å, Nog1-TAP associated immature ribosomal particle population C from S. cerevisiae
7BT6 3.12 Å, Cryo-EM structure of pre-60S ribosome from Saccharomyces cerevisiae rpl4delta63-87…
4WJV 3.2 Å, Crystal structure of Rsa4 in complex with the Nsa2 binding peptide
6M62 3.2 Å, Cryo-Em structure of eukaryotic pre-60S ribosome subunit from Saccharomyces cerevisiae…

Browse structure collections

About this viewer

MolViewer shows 4WJU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.