4WV6: Importin subunit alpha-1

Heterodimer of Importin alpha 1 with nuclear localization signal of TAF8. Determined by X-ray diffraction at 1.75 Å resolution. Released 28 Jan 2015.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,877
Mol. weight: 55.08 kDa
Released: 28 Jan 2015

Explore 4WV6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4WV6 contains 33 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 33 helices, 0 β-strands

Element	Residues	Length
α-helix	74-85	12
α-helix	90-104	15
α-helix	112-117	6
α-helix	121-128	8
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-213	8
α-helix	218-220	3
α-helix	223-236	14
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-344	5
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-388	10
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-454	21
α-helix	457-466	10
α-helix	469-475	7
α-helix	476-478	3
α-helix	482-495	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-1	A	protein	471	Homo sapiens	P52292 (AlphaFold model)
Transcription initiation factor TFIID subunit 8	B, C	protein	14	Homo sapiens	Q7Z7C8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>4WV6_1 Importin subunit alpha-1 (chains A)
GATSPLQENRNNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRA
GLIPKFVSFLGRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHI
SEQAVWALGNIAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCR
NKNPAPPIDAVEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQL
VKLLGASELPIVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWT
MSNITAGRQDQIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVH
CGIIEPLMNLLTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQN
HENESVYKASLSLIEKYFSVEEEEDQNVVPETTSEGYTFQVQDGAPGTFNF

Sequence of entity 2 (B, C), FASTA

>4WV6_2 Transcription initiation factor TFIID subunit 8 (chains B, C)
PVKKPKIRRKKSLS

Primary citation

Cytoplasmic TAF2-TAF8-TAF10 complex provides evidence for nuclear holo-TFIID assembly from preformed submodules. Trowitzsch, S., Viola, C., Scheer, E. et al. Nat Commun (2015) 6:6011-6011. DOI 10.1038/ncomms7011 · PubMed

Other PDB entries of the same protein (UniProt P52292 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FZK 2.1 Å, Dimeric human importin alpha subunit
3FEY 2.2 Å, Crystal structure of the CBC-importin alpha complex.
7N9H 2.2 Å, Structure of the mammalian importin a1 bound to the TDP-43 NLS
1QGR 2.3 Å, Structure of importin beta bound to the ibb domain of importin alpha (II crystal form,…
5H43 2.3 Å, Structural and mechanistical studies of the nuclear import by Importin-alpha
1QGK 2.5 Å, Structure of importin beta bound to the ibb domain of importin alpha
4E4V 2.53 Å, The crystal structure of the dimeric human importin alpha 1 at 2.5 angstrom resolution.
3WPT 2.63 Å, Crystal structure of closed dimer of human importin-alpha1 (Rch1)
7CRU 2.8 Å, hnRNPK NLS in complex with Importin alpha 1 (KPNA2)
1EFX 3.0 Å, Structure of a complex between the human natural killer cell receptor KIR2DL2 and a…
7N8J 3.2 Å, Human importin alpha 1 in complex with Bimax2 peptide
9BFC 3.2 Å, Cryo-EM structure of importin alpha-1/beta bound to FG repeats

Browse structure collections

About this viewer

MolViewer shows 4WV6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.