5H43: Importin subunit alpha-1

Structural and mechanistical studies of the nuclear import by Importin-alpha. Determined by X-ray diffraction at 2.3 Å resolution. Released 25 Oct 2017.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Homo sapiens
Chains: 3
Atoms: 3,614
Mol. weight: 49.49 kDa
Released: 25 Oct 2017

Explore 5H43 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H43 contains 37 α-helices and 0 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 34 helices, 0 β-strands

Element	Residues	Length
α-helix	73-75	3
α-helix	78-86	9
α-helix	90-104	15
α-helix	112-117	6
α-helix	121-128	8
α-helix	134-147	14
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-213	8
α-helix	218-220	3
α-helix	223-236	14
α-helix	243-245	3
α-helix	246-259	14
α-helix	265-278	14
α-helix	283-290	8
α-helix	295-302	8
α-helix	310-320	11
α-helix	325-334	10
α-helix	336-339	4
α-helix	340-345	6
α-helix	349-363	15
α-helix	367-375	9
α-helix	379-388	10
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-453	20
α-helix	457-466	10
α-helix	469-475	7
α-helix	476-478	3
α-helix	482-496	15

Chain B: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	141-143	3
α-helix	146-148	3

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	133-135	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-1	A	protein	429	Homo sapiens	P52292 (AlphaFold model)
Histone acetyltransferase KAT8	B	protein	10	Homo sapiens	Q9H7Z6 (AlphaFold model)
Histone acetyltransferase KAT8	C	protein	15	Homo sapiens	Q9H7Z6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5H43_1 Importin subunit alpha-1 (chains A)
SNQGTVNWSVDDIVKGINSSNVENQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFL
GRTDCSPIQFESAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGN
IAGDGSVFRDLVIKYGAVDPLLALLAVPDMSSLACGYLRNLTWTLSNLCRNKNPAPPIDA
VEQILPTLVRLLHHDDPEVLADTCWAISYLTDGPNERIGMVVKTGVVPQLVKLLGASELP
IVTPALRAIGNIVTGTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQD
QIQQVVNHGLVPFLVSVLSKADFKTQKEAVWAVTNYTSGGTVEQIVYLVHCGIIEPLMNL
LTAKDTKIILVILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQNHENESVYKAS
LSLIEKYFS

Sequence of entity 2 (B), FASTA

>5H43_2 Histone acetyltransferase KAT8 (chains B)
RNQKRKHDEI

Sequence of entity 3 (C), FASTA

>5H43_3 Histone acetyltransferase KAT8 (chains C)
SELAEQPERKITRNQ

Primary citation

Structural insights into the nuclear import of the histone acetyltransferase males-absent-on-the-first by importin alpha 1. Zheng, W., Wang, R., Liu, X. et al. Traffic (2018) 19:19-28. DOI 10.1111/tra.12534 · PubMed

Other PDB entries of the same protein (UniProt P52292 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4WV6 1.75 Å, Heterodimer of Importin alpha 1 with nuclear localization signal of TAF8
8FZK 2.1 Å, Dimeric human importin alpha subunit
3FEY 2.2 Å, Crystal structure of the CBC-importin alpha complex.
7N9H 2.2 Å, Structure of the mammalian importin a1 bound to the TDP-43 NLS
1QGR 2.3 Å, Structure of importin beta bound to the ibb domain of importin alpha (II crystal form,…
1QGK 2.5 Å, Structure of importin beta bound to the ibb domain of importin alpha
4E4V 2.53 Å, The crystal structure of the dimeric human importin alpha 1 at 2.5 angstrom resolution.
3WPT 2.63 Å, Crystal structure of closed dimer of human importin-alpha1 (Rch1)
7CRU 2.8 Å, hnRNPK NLS in complex with Importin alpha 1 (KPNA2)
1EFX 3.0 Å, Structure of a complex between the human natural killer cell receptor KIR2DL2 and a…
7N8J 3.2 Å, Human importin alpha 1 in complex with Bimax2 peptide
9BFC 3.2 Å, Cryo-EM structure of importin alpha-1/beta bound to FG repeats

Browse structure collections

About this viewer

MolViewer shows 5H43 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.