Crystal Structure of core/latch dimer of Bax in complex with BimBH3mini. Determined by X-ray diffraction at 2.4 Å resolution. Released 22 Jul 2015.
Explore 4ZIF in 3D Show helices and sheets RCSB PDB PDBe
4ZIF contains 10 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-34 | 19 | |
| α-helix | 49-51 | 3 | |
| α-helix | 54-71 | 18 | |
| α-helix | 74-82 | 9 | |
| α-helix | 88-99 | 12 | |
| α-helix | 107-143 | 37 | |
| α-helix | 144-148 | 5 | |
| α-helix | 149-154 | 6 | |
| α-helix | 159-164 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 145-158 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Apoptosis regulator BAX | A | protein | 168 | Homo sapiens | Q07812 (AlphaFold model) |
| Bcl-2-like protein 11 | B | protein | 20 | Homo sapiens | O43521 (AlphaFold model) |
>4ZIF_1 Apoptosis regulator BAX (chains A) MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLS ESLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKL VLKALSTKVPELIRTIMGWTLDFLRERLLGWIQDQGGWDGLLSYFGSS
>4ZIF_2 Bcl-2-like protein 11 (chains B) DMRPEIWIAQELRRIGDEFN
Crystal structure of Bax bound to the BH3 peptide of Bim identifies important contacts for interaction. Robin, A.Y., Krishna Kumar, K., Westphal, D. et al. Cell Death Dis (2015) 6:e1809-e1809. DOI 10.1038/cddis.2015.141 · PubMed
Other PDB entries of the same protein (UniProt Q07812 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 4ZIF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.