4ZNY: Human TSG101-UEV Domain

Structure of the human TSG101-UEV Domain in complex with the PTAP motif of the p19 gag protein of the Human T-cell Leukemia type I virus. Determined by X-ray diffraction at 2.4 Å resolution. Released 29 Jun 2016.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, Human T-lymphotropic virus 1
Chains: 2
Atoms: 1,168
Mol. weight: 17.54 kDa
Released: 29 Jun 2016

Explore 4ZNY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4ZNY contains 8 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	18-31	14
β-strand	35-43	9	1
β-strand	49-63	15	1
β-strand	66-76	11	1
α-helix	77	1
β-strand	86-89	4	1
β-strand	95-97	3	2
β-strand	103	1	3
β-strand	108	1	1
β-strand	109	1	3
α-helix	112-115	4
α-helix	124-137	14
β-strand	141-143	3	2

Chain B: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	106-108	3
α-helix	111	1
β-strand	112	1	2
α-helix	113	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor susceptibility gene 101 protein	A	protein	142	Homo sapiens	Q99816 (AlphaFold model)
T-cell leukemia virus type I, partial gag gene; HTLV1 (human T-lymphotropic virus type I)	B	protein	10	Human T-lymphotropic virus 1	P14078

Sequence of entity 1 (A), FASTA

>4ZNY_1 Tumor susceptibility gene 101 protein (chains A)
SESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPY
RGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSD
LLGLIQVMIVVFGDEPPVFSRP

Sequence of entity 2 (B), FASTA

>4ZNY_2 T-cell leukemia virus type I, partial gag gene; HTLV1 (human T-lymphotropic virus type I) (chains B)
YVEPTAPQVL

Primary citation

Structure of the human TSG101-UEV Domain in complex with the PTAP motif of the p19 gag protein of the Human T-cell Leukemia type I virus. Camara-Artigas, A., Bacarizo, J. To be published.

Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NLC 1.4 Å, Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
3P9H 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
7ZLX 2.25 Å, Crystal Structure of the TSG101-UEV domain:space group P21

Browse structure collections

About this viewer

MolViewer shows 4ZNY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.