5CJ4: Amino Acids 1562-1622 of MYH7

Crystal Structure of Amino Acids 1562-1622 of MYH7. Determined by X-ray diffraction at 3.1 Å resolution. Released 2 Dec 2015.

Method: X-ray diffraction
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,343
Mol. weight: 96.43 kDa
Released: 2 Dec 2015

Explore 5CJ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5CJ4 contains 21 α-helices and 36 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	10	1	2
α-helix	17	1
β-strand	18-24	7	1
α-helix	28-30	3
β-strand	32-37	6	1
β-strand	42-47	6	1
α-helix	49-58	10
α-helix	63-74	12
β-strand	84-89	6	2
β-strand	94-101	8	2
β-strand	104-112	9	2
β-strand	114-115	2	1
α-helix	116	1
α-helix	119-1614	79

Chain B: 6 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	3
β-strand	10	1	4
α-helix	17	1
β-strand	18-24	7	3
α-helix	28-30	3
β-strand	32-37	6	3
β-strand	42-47	6	3
α-helix	49-58	10
α-helix	63-74	12
β-strand	84-89	6	4
β-strand	94-101	8	4
β-strand	104-112	9	4
β-strand	114-115	2	3
α-helix	116	1
α-helix	119-1607	72

Chain C: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	5
β-strand	10	1	6
β-strand	17-24	8	5
α-helix	28-30	3
β-strand	31-37	7	5
β-strand	42-48	7	5
α-helix	49-58	10
α-helix	63-74	12
β-strand	84-89	6	6
β-strand	94-100	7	6
β-strand	105-112	8	6
β-strand	114-115	2	5
α-helix	116	1
α-helix	119-1618	83

Chain D: 4 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	7
β-strand	10	1	8
β-strand	17-24	8	7
α-helix	28-30	3
β-strand	31-37	7	7
β-strand	42-48	7	7
α-helix	49-58	10
α-helix	63-74	12
β-strand	84-89	6	8
β-strand	94-101	8	8
β-strand	104-112	9	8
β-strand	114-115	2	7
α-helix	119-1610	75

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Xrcc4-MYH7-(1562-1622) chimera protein	A, B, C, D	protein	208	Homo sapiens	P12883 (AlphaFold model), Q13426 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5CJ4_1 Xrcc4-MYH7-(1562-1622) chimera protein (chains A, B, C, D)
GGSGERKISRIHLVSEPSITHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEAD
DMAMEKGKYVGELRKALLSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVE
NPAEVIRELICYCLDTTAENQAKNEHLQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVV
DSLQTSLDAETRSRNEALRVKKKMEGDL

Primary citation

A composite approach towards a complete model of the myosin rod. Korkmaz, E.N., Taylor, K.C., Andreas, M.P. et al. Proteins (2016) 84:172-189. DOI 10.1002/prot.24964 · PubMed

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CJ1 2.1 Å, Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7
6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
6PFP 2.2 Å, Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
9HTF 2.48 Å, Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7

Browse structure collections

About this viewer

MolViewer shows 5CJ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.