5F5S: Prp38-MFAP1 complex of Homo sapiens

Crystal structure of the Prp38-MFAP1 complex of Homo sapiens. Determined by X-ray diffraction at 2.4 Å resolution. Released 12 Oct 2016.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,983
Mol. weight: 31.11 kDa
Released: 12 Oct 2016

Explore 5F5S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5F5S contains 16 α-helices and 9 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	1-3	3
α-helix	5-6	2
β-strand	12	1	1
β-strand	15	1	1
α-helix	17-20	4
α-helix	23-31	9
α-helix	33-38	6
α-helix	44-51	8
β-strand	57-58	2	2
β-strand	60-61	2	3
β-strand	66-67	2	3
α-helix	68	1
α-helix	69-80	12
α-helix	84-92	9
α-helix	97-110	14
α-helix	113-120	8
α-helix	121-125	5
β-strand	129-133	5	2
β-strand	139-143	5	2
α-helix	144-153	10
β-strand	156-157	2	4
β-strand	160-161	2	4
α-helix	162-164	3
α-helix	168-174	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	273-321	49

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Pre-mRNA-splicing factor 38A	A	protein	181	Homo sapiens	Q8NAV1 (AlphaFold model)
Microfibrillar-associated protein 1	B	protein	80	Homo sapiens	P55081 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5F5S_1 Pre-mRNA-splicing factor 38A (chains A)
GAMANRTVKDAHSIHGTNPQYLVEKIIRTRIYESKYWKEECFGLTAELVVDKAMELRFVG
GVYGGNIKPTPFLCLTLKMLQIQPEKDIIVEFIKNEDFKYVRMLGALYMRLTGTAIDCYK
YLEPLYNDYRKIKSQNRNGEFELMHVDEFIDELLHSERVCDIILPRLQKRYVLEEAEQLE
P

Sequence of entity 2 (B), FASTA

>5F5S_2 Microfibrillar-associated protein 1 (chains B)
GATDDENDEEEYEAWKVRELKRIKRDREDREALEKEKAEIERMRNLTEEERRAELRANGK
VITNKAVKGKYKFLQKYYHR

Primary citation

Scaffolding in the Spliceosome via Single alpha Helices. Ulrich, A.K.C., Seeger, M., Schutze, T. et al. Structure (2016) 24:1972-1983. DOI 10.1016/j.str.2016.09.007 · PubMed

Other PDB entries of the same protein (UniProt Q8NAV1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4RZ9 1.28 Å, Pre-mRNA-splicing factor 38A AS 1-179
4RZA 1.9 Å, Pre-mRNA-splicing factor 38A AS 1-205
8H6K 2.7 Å, Cryo-EM structure of human exon-defined spliceosome in the mature B state.
8Q7N 3.1 Å, cryo-EM structure of the human spliceosomal B complex protomer (tri-snRNP core region)
8QPE 3.1 Å, Cryo-EM Structure of Pre-B-like Complex (core part)
9R3D 3.12 Å, Cryo-EM structure of the human pre-Bact-OTS complex (whole map)
6AHD 3.8 Å, The Cryo-EM Structure of Human Pre-catalytic Spliceosome (B complex) at 3.8 angstrom…
7ABF 3.9 Å, Human pre-Bact-1 spliceosome core structure
8QZS 4.1 Å, Cryo-EM structure of the cross-exon B-like complex
7AAV 4.2 Å, Human pre-Bact-2 spliceosome core structure
5O9Z 4.5 Å, Cryo-EM structure of a pre-catalytic human spliceosome primed for activation (B complex)
8QO9 5.29 Å, Cryo-EM structure of a human spliceosomal B complex protomer

Browse structure collections

About this viewer

MolViewer shows 5F5S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.