5FBH: Extracellular calcium-sensing receptor

Crystal structure of the extracellular domain of human calcium sensing receptor with bound Gd3+. Determined by X-ray diffraction at 2.7 Å resolution. Released 22 Jun 2016.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,394
Mol. weight: 130.99 kDa
Ligands: GD3, MG, BCT, NAG
Released: 22 Jun 2016

Explore 5FBH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FBH contains 50 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	7
β-strand	32-38	7	7
β-strand	41-44	4	8
α-helix	54-58	5
β-strand	60-63	4	8
α-helix	65-83	19
β-strand	93-99	7	7
α-helix	104-114	11
α-helix	116-120	5
β-strand	138-142	5	7
α-helix	147-159	13
β-strand	164-166	3	7
α-helix	172-175	4
β-strand	183-185	3	7
α-helix	191-203	13
β-strand	208-214	7	9
α-helix	219-232	14
β-strand	236-243	8	9
α-helix	249-260	12
β-strand	266-270	5	9
α-helix	273-285	13
β-strand	292-295	4	9
α-helix	297-300	4
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-321	4	9
α-helix	322-324	3
β-strand	325	1	10
α-helix	330-335	6
β-strand	345	1	7
α-helix	348-356	9
β-strand	359	1	11
α-helix	393	1
β-strand	394	1	11
α-helix	395	1
α-helix	401-403	3
β-strand	414	1	10
α-helix	416-435	20
α-helix	445-447	3
α-helix	457-466	10
β-strand	468-470	3	12
β-strand	476-478	3	12
β-strand	489-496	8	9
α-helix	497	1
β-strand	503-511	9	9
α-helix	516	1
β-strand	521-523	3	9
α-helix	525-527	3

Chain B: 25 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	1
β-strand	32-38	7	1
β-strand	41-44	4	2
β-strand	60-63	4	2
α-helix	65-83	19
β-strand	93-99	7	1
α-helix	104-114	11
α-helix	116-120	5
β-strand	138-142	5	1
α-helix	147-157	11
α-helix	158-160	3
β-strand	164-166	3	1
α-helix	172-175	4
β-strand	183-185	3	1
α-helix	190-203	14
β-strand	208-214	7	3
α-helix	219-232	14
β-strand	236-243	8	3
α-helix	249-260	12
β-strand	266-270	5	3
α-helix	273-285	13
α-helix	291	1
β-strand	292-295	4	3
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-322	5	3
α-helix	323-324	2
β-strand	325	1	4
α-helix	330-334	5
β-strand	345	1	1
α-helix	348-356	9
β-strand	359	1	5
α-helix	392-393	2
β-strand	394	1	5
α-helix	395	1
α-helix	401-403	3
β-strand	414	1	4
α-helix	416-435	20
α-helix	437-438	2
α-helix	445-447	3
α-helix	452-454	3
α-helix	457-466	10
β-strand	469-470	2	6
β-strand	476-477	2	6
β-strand	489-496	8	3
β-strand	503-511	9	3
β-strand	521-523	3	3
α-helix	525-527	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Extracellular calcium-sensing receptor	A, B	protein	568	Homo sapiens	P41180 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FBH_1 Extracellular calcium-sensing receptor (chains A, B)
MRLLTALFAYFIVALILAFSVSAKSMHHHHHHHHSAWSHPQFEKEFYGPDQRAQKKGDII
LGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTL
GYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAV
ANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIA
ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSG
PDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREF
LKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRP
LCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIK
KVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNV
YAKKGERLFINEEKILWSGFSREVPFSN

Ligands and cofactors

ID	Name	Formula	Copies
GD3	Gadolinium ion	Gd	2
MG	Magnesium ion	Mg	3
BCT	Bicarbonate ion	C H O3	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	7
TCR	Cyclomethyltryptophan	C12 H12 N2 O2	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural basis for regulation of human calcium-sensing receptor by magnesium ions and an unexpected tryptophan derivative co-agonist. Zhang, C., Zhang, T., Zou, J. et al. Sci Adv (2016) 2:e1600241-e1600241. DOI 10.1126/sciadv.1600241 · PubMed

Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FBK 2.1 Å, Crystal structure of the extracellular domain of human calcium sensing receptor
7M3G 2.5 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
5K5S 2.6 Å, Crystal structure of the active form of human calcium-sensing receptor extracellular…
7SIL 2.7 Å, Structure of positive allosteric modulator-bound active human calcium-sensing receptor
7SIM 2.7 Å, Structure of positive allosteric modulator-free active human calcium-sensing receptor
8WPG 2.7 Å, Human calcium-sensing receptor bound with cinacalcet in detergent
7M3F 2.8 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
8SZF 2.8 Å, Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR…
9C1P 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218
9C2F 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149
7E6T 3.0 Å, Structural insights into the activation of human calcium-sensing receptor
5K5T 3.1 Å, Crystal structure of the inactive form of human calcium-sensing receptor extracellular…

Browse structure collections

About this viewer

MolViewer shows 5FBH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.