5FBK: Extracellular calcium-sensing receptor

Crystal structure of the extracellular domain of human calcium sensing receptor. Determined by X-ray diffraction at 2.1 Å resolution. Released 22 Jun 2016.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,901
Mol. weight: 131.04 kDa
Ligands: MG, BCT, NAG, TCR
Released: 22 Jun 2016

Explore 5FBK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5FBK contains 52 α-helices and 48 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	1
β-strand	32-38	7	1
β-strand	41-44	4	2
α-helix	54-59	6
β-strand	60-63	4	2
α-helix	65-82	18
β-strand	93-99	7	1
α-helix	104-114	11
α-helix	116-123	8
α-helix	125-128	4
α-helix	136-137	2
β-strand	138-142	5	1
α-helix	147-159	13
β-strand	164-166	3	1
α-helix	172-175	4
β-strand	183-185	3	1
α-helix	191-203	13
β-strand	209-214	6	3
α-helix	219-232	14
β-strand	237-243	7	3
α-helix	249-261	13
β-strand	266-270	5	3
α-helix	273-285	13
β-strand	292-295	4	3
α-helix	297-300	4
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-322	5	3
α-helix	323-324	2
β-strand	325	1	4
α-helix	330-335	6
β-strand	345	1	1
α-helix	348-356	9
β-strand	359	1	5
α-helix	393	1
β-strand	394	1	5
α-helix	395	1
α-helix	401-403	3
β-strand	414	1	4
α-helix	416-435	20
α-helix	445-447	3
α-helix	452-454	3
α-helix	457-465	9
β-strand	468-470	3	6
β-strand	476-478	3	6
β-strand	489-496	8	3
β-strand	503-511	9	3
β-strand	521-523	3	3
α-helix	525-527	3
α-helix	528-529	2
β-strand	530	1	7
β-strand	534	1	7

Chain B: 25 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	8
β-strand	32-38	7	8
β-strand	41-44	4	9
α-helix	54-59	6
β-strand	60-63	4	9
α-helix	65-82	18
β-strand	93-99	7	8
α-helix	104-114	11
α-helix	116-120	5
β-strand	138-142	5	8
α-helix	147-157	11
α-helix	158-160	3
β-strand	164-166	3	8
α-helix	172-175	4
β-strand	183-185	3	8
α-helix	190-203	14
β-strand	208-214	7	10
α-helix	219-232	14
β-strand	236-243	8	10
α-helix	249-261	13
β-strand	266-270	5	10
α-helix	273-285	13
β-strand	292-295	4	10
α-helix	297-300	4
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-322	5	10
α-helix	323-324	2
β-strand	325	1	11
α-helix	330-335	6
β-strand	345	1	8
α-helix	348-356	9
β-strand	359	1	12
α-helix	393	1
β-strand	394	1	12
α-helix	395	1
α-helix	401-403	3
β-strand	414	1	11
α-helix	416-435	20
α-helix	445-447	3
α-helix	452-454	3
α-helix	457-465	9
β-strand	469-470	2	13
β-strand	476-477	2	13
β-strand	489-496	8	10
β-strand	503-511	9	10
β-strand	521-523	3	10
α-helix	525-527	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Extracellular calcium-sensing receptor	A, B	protein	568	Homo sapiens	P41180 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5FBK_1 Extracellular calcium-sensing receptor (chains A, B)
MRLLTALFAYFIVALILAFSVSAKSMHHHHHHHHSAWSHPQFEKEFYGPDQRAQKKGDII
LGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTL
GYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAV
ANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIA
ADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSG
PDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREF
LKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRP
LCTGDENISSVETPYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIK
KVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNV
YAKKGERLFINEEKILWSGFSREVPFSN

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	3
BCT	Bicarbonate ion	C H O3	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	8
TCR	Cyclomethyltryptophan	C12 H12 N2 O2	2

Water and common crystallization additives (CL) are not listed.

Primary citation

Structural basis for regulation of human calcium-sensing receptor by magnesium ions and an unexpected tryptophan derivative co-agonist. Zhang, C., Zhang, T., Zou, J. et al. Sci Adv (2016) 2:e1600241-e1600241. DOI 10.1126/sciadv.1600241 · PubMed

Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7M3G 2.5 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
5K5S 2.6 Å, Crystal structure of the active form of human calcium-sensing receptor extracellular…
5FBH 2.7 Å, Crystal structure of the extracellular domain of human calcium sensing receptor with…
7SIL 2.7 Å, Structure of positive allosteric modulator-bound active human calcium-sensing receptor
7SIM 2.7 Å, Structure of positive allosteric modulator-free active human calcium-sensing receptor
8WPG 2.7 Å, Human calcium-sensing receptor bound with cinacalcet in detergent
7M3F 2.8 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
8SZF 2.8 Å, Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR…
9C1P 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218
9C2F 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149
7E6T 3.0 Å, Structural insights into the activation of human calcium-sensing receptor
5K5T 3.1 Å, Crystal structure of the inactive form of human calcium-sensing receptor extracellular…

Browse structure collections

About this viewer

MolViewer shows 5FBK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.