7M3G: Extracellular calcium-sensing receptor

Asymmetric Activation of the Calcium Sensing Receptor Homodimer. Determined by electron microscopy at 2.5 Å resolution. Released 30 Jun 2021.

Method: Electron microscopy
Resolution: 2.5 Å
Organisms: Homo sapiens, synthetic construct
Chains: 4
Atoms: 13,298
Mol. weight: 210.06 kDa
Ligands: PO4, CA, TRP, NAG
Released: 30 Jun 2021

Explore 7M3G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7M3G contains 75 α-helices and 68 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	1
β-strand	32-38	7	1
β-strand	41	1	2
β-strand	44	1	3
β-strand	60	1	3
β-strand	63	1	2
α-helix	65-83	19
β-strand	93-99	7	1
α-helix	104-114	11
α-helix	116-123	8
β-strand	138-143	6	1
α-helix	147-157	11
β-strand	164-166	3	1
α-helix	172-175	4
β-strand	183-185	3	1
α-helix	191-203	13
β-strand	208-214	7	4
α-helix	219-232	14
β-strand	236-243	8	4
α-helix	249-259	11
β-strand	266-270	5	4
α-helix	273-286	14
β-strand	292-295	4	4
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-321	4	4
β-strand	325	1	5
α-helix	330-334	5
β-strand	345	1	1
α-helix	348-356	9
β-strand	359	1	6
α-helix	393	1
β-strand	394	1	6
α-helix	395	1
α-helix	401-403	3
β-strand	414	1	5
α-helix	416-435	20
α-helix	437-438	2
α-helix	457-465	9
β-strand	468-470	3	7
β-strand	476-478	3	7
β-strand	489-496	8	4
β-strand	503-511	9	4
β-strand	521-523	3	4
α-helix	525-527	3
α-helix	537-539	3
α-helix	544-546	3
β-strand	550-554	5	8
α-helix	555	1
β-strand	563-567	5	8
β-strand	573	1	9
β-strand	583	1	9
β-strand	589-591	3	10
β-strand	598-600	3	10
α-helix	601	1
β-strand	602-604	3	11
α-helix	611-636	26
α-helix	641-645	5
α-helix	650-663	14
α-helix	664-668	5
α-helix	681-696	16
α-helix	725-745	21
β-strand	749-753	5	11
β-strand	760-766	7	11
α-helix	771-793	23
α-helix	803-820	18
α-helix	822-827	6
α-helix	834-852	19
α-helix	854-862	9
α-helix	869-872	4
α-helix	880-885	6

Chain B: 37 helices, 34 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	12
β-strand	32-38	7	12
β-strand	41-44	4	13
β-strand	60-63	4	13
α-helix	65-82	18
β-strand	93-99	7	12
α-helix	104-114	11
α-helix	116-123	8
β-strand	138-142	5	12
α-helix	147-157	11
β-strand	164-166	3	12
α-helix	172-175	4
β-strand	183-185	3	12
α-helix	191-203	13
β-strand	208-214	7	14
α-helix	219-232	14
β-strand	236-243	8	14
α-helix	249-260	12
β-strand	266-270	5	14
α-helix	273-285	13
β-strand	292-295	4	14
α-helix	308-310	3
α-helix	311-314	4
β-strand	318-321	4	14
β-strand	325	1	15
α-helix	330-335	6
β-strand	345	1	12
α-helix	348-356	9
β-strand	359	1	16
α-helix	393	1
β-strand	394	1	16
α-helix	395-396	2
α-helix	401-403	3
β-strand	414	1	15
α-helix	416-435	20
α-helix	452-454	3
α-helix	457-465	9
β-strand	468-470	3	17
β-strand	476-478	3	17
β-strand	489-496	8	14
β-strand	503-511	9	14
α-helix	516	1
β-strand	521-523	3	14
α-helix	525-527	3
β-strand	530	1	18
β-strand	534	1	18
α-helix	537-539	3
α-helix	544-546	3
β-strand	550-554	5	19
β-strand	563-567	5	19
β-strand	572-573	2	20
α-helix	582	1
β-strand	583-584	2	20
α-helix	585	1
β-strand	589-591	3	21
β-strand	598-600	3	21
α-helix	601	1
β-strand	602-604	3	22
α-helix	611-636	26
α-helix	648-663	16
α-helix	664-667	4
α-helix	681-697	17
α-helix	723-745	23
β-strand	749-753	5	22
β-strand	760-766	7	22
α-helix	770-792	23
α-helix	803-820	18
α-helix	822-824	3
α-helix	832-853	22
α-helix	855-857	3
α-helix	858-862	5

Chain D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Extracellular calcium-sensing receptor	A, B	protein	902	Homo sapiens	P41180 (AlphaFold model)
etelcalcetide	C, D	protein	9	synthetic construct

Sequence of entity 1 (A, B), FASTA

>7M3G_1 Extracellular calcium-sensing receptor (chains A, B)
MKTIIALSYIFCLVFADYKDDDDKAAAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLK
SRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATL
SFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSR
LLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEE
RDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKI
WLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFW
EETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYT
HLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNN
MGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSG
FSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSN
ENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSY
LLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPT
SFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMA
LGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKF
VSAVEVIAILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRS
NV

Sequence of entity 2 (C, D), FASTA

>7M3G_2 etelcalcetide (chains C, D)
XCARRRARX

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	2
CA	Calcium ion	Ca	4
TRP	Tryptophan	C11 H12 N2 O2	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5
H43	2-[4-[(3S)-3-[[(1R)-1-naphthalen-1-ylethyl]amino]pyrrolidin-1-yl]phenyl]ethanoi…	C24 H26 N2 O2	2

Primary citation

Asymmetric activation of the calcium-sensing receptor homodimer. Gao, Y., Robertson, M.J., Rahman, S.N. et al. Nature (2021) 595:455-459. DOI 10.1038/s41586-021-03691-0 · PubMed

Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FBK 2.1 Å, Crystal structure of the extracellular domain of human calcium sensing receptor
5K5S 2.6 Å, Crystal structure of the active form of human calcium-sensing receptor extracellular…
5FBH 2.7 Å, Crystal structure of the extracellular domain of human calcium sensing receptor with…
7SIL 2.7 Å, Structure of positive allosteric modulator-bound active human calcium-sensing receptor
7SIM 2.7 Å, Structure of positive allosteric modulator-free active human calcium-sensing receptor
8WPG 2.7 Å, Human calcium-sensing receptor bound with cinacalcet in detergent
7M3F 2.8 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
8SZF 2.8 Å, Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR…
9C1P 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218
9C2F 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149
7E6T 3.0 Å, Structural insights into the activation of human calcium-sensing receptor
5K5T 3.1 Å, Crystal structure of the inactive form of human calcium-sensing receptor extracellular…

Browse structure collections

About this viewer

MolViewer shows 7M3G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.