9C2F: Calcium-Sensing Receptor

Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '54149. Determined by electron microscopy at 2.8 Å resolution. Released 2 Oct 2024.

Method: Electron microscopy
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 12,163
Mol. weight: 217.06 kDa
Ligands: NAG, CA, TRP, PO4
Released: 2 Oct 2024

Explore 9C2F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9C2F contains 62 α-helices and 70 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	26-27	2	1
β-strand	32-38	7	1
β-strand	41	1	2
β-strand	44	1	3
β-strand	60	1	3
β-strand	63	1	2
α-helix	65-83	19
β-strand	93-99	7	1
α-helix	104-114	11
β-strand	138-142	5	1
α-helix	147-157	11
β-strand	164-166	3	1
α-helix	172-175	4
β-strand	183-185	3	1
α-helix	191-203	13
β-strand	209-214	6	4
α-helix	219-232	14
β-strand	237-243	7	4
α-helix	249-261	13
β-strand	266-270	5	4
α-helix	273-286	14
β-strand	292-295	4	4
α-helix	311-314	4
β-strand	318-322	5	4
α-helix	323-324	2
β-strand	325	1	5
α-helix	331-335	5
β-strand	345	1	1
α-helix	348-356	9
β-strand	359	1	6
α-helix	392-393	2
β-strand	394	1	6
α-helix	401-403	3
β-strand	414	1	5
α-helix	416-435	20
α-helix	457-465	9
β-strand	468-470	3	7
β-strand	476-478	3	7
β-strand	489-494	6	4
β-strand	505-511	7	4
β-strand	521-523	3	4
α-helix	525-527	3
α-helix	537-539	3
β-strand	550-553	4	8
α-helix	554-555	2
β-strand	564-567	4	8
β-strand	589-591	3	9
β-strand	598-600	3	9
α-helix	601	1
β-strand	602-604	3	10
α-helix	611-636	26
α-helix	641-645	5
α-helix	648-663	16
α-helix	666-668	3
α-helix	676-697	22
α-helix	725-745	21
β-strand	752-753	2	10
β-strand	760-763	4	10
α-helix	770-792	23
α-helix	799-802	4
α-helix	804-819	16
α-helix	822-825	4
α-helix	833-859	27

Chain B: 31 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	26-28	3	11
β-strand	32-38	7	11
β-strand	41	1	12
β-strand	44	1	13
α-helix	57-59	3
β-strand	60	1	13
β-strand	63	1	12
α-helix	65-83	19
β-strand	93-99	7	11
α-helix	104-114	11
β-strand	138-142	5	11
α-helix	147-157	11
β-strand	164-166	3	11
α-helix	172-175	4
β-strand	183-185	3	11
α-helix	191-203	13
β-strand	208-214	7	14
α-helix	219-232	14
β-strand	236-243	8	14
α-helix	249-261	13
β-strand	266-270	5	14
α-helix	273-286	14
β-strand	292-295	4	14
α-helix	308-314	7
β-strand	318-322	5	14
β-strand	325	1	15
α-helix	330-335	6
α-helix	348-356	9
β-strand	359	1	16
β-strand	394	1	16
α-helix	401-403	3
β-strand	414	1	15
α-helix	416-436	21
α-helix	437-438	2
α-helix	445-447	3
α-helix	452-454	3
α-helix	457-465	9
β-strand	468-470	3	17
β-strand	476-478	3	17
β-strand	489-496	8	14
β-strand	503-511	9	14
β-strand	521-523	3	14
α-helix	525-527	3
β-strand	530	1	18
β-strand	534	1	18
α-helix	537-538	2
α-helix	544-546	3
β-strand	550-554	5	19
β-strand	563-567	5	19
β-strand	572-573	2	20
β-strand	579	1	19
β-strand	583-584	2	20
α-helix	585-586	2
β-strand	589-591	3	21
β-strand	598-600	3	21
α-helix	601	1
β-strand	602-604	3	22
α-helix	611-636	26
α-helix	648-664	17
α-helix	680-697	18
α-helix	724-745	22
β-strand	749	1	23
β-strand	752-753	2	22
β-strand	760-763	4	22
β-strand	766	1	23
α-helix	771-793	23
α-helix	799-820	22
α-helix	822-826	5
α-helix	832-860	29

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Extracellular calcium-sensing receptor	A	protein	959	Homo sapiens	P41180 (AlphaFold model)
Extracellular calcium-sensing receptor	B	protein	939	Homo sapiens	P41180 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9C2F_1 Extracellular calcium-sensing receptor (chains A)
WSHPQFEKGGGSGGGSGGSAWSHPQFEKGSAAAYGPDQRAQKKGDIILGGLFPIHFGVAA
KDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSK
ALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVS
YASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKF
REEAEERDICIDFSELISQYSDEEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRR
NITGKIWLASEAWASSSLIAMPQYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNG
FAKEFWEETFNCHLQEGAKGPLPVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVET
PYIDYTHLRISYNVYLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRH
LNFTNNMGEQVTFDECGDLVGNYSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEE
KILWSGFSREVPFSNCSRDCLAGTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCP
DDFWSNENHTSCIAKEIEFLSWTEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKAT
NRELSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVF
EAKIPTSFHRKWWGLNLQFLLVFLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCH
EGSLMALGFLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYA
STYGKFVSAVEVIAILAASFGLLACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAAR
ATLRRSNVTGSSTNNNEEEKSRLLEKENRELEKIIAEKEERVSELRHQLQSRQQLKKTN

Sequence of entity 2 (B), FASTA

>9C2F_2 Extracellular calcium-sensing receptor (chains B)
DYKDDDDKAAAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGF
RWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEF
CNCSEHIPSTIAVVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIP
NDEHQATAMADIIEYFRWNWVGTIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSD
EEEIQHVVEVIQNSTAKVIVVFSSGPDLEPLIKEIVRRNITGKIWLASEAWASSSLIAMP
QYFHVVGGTIGFALKAGQIPGFREFLKKVHPRKSVHNGFAKEFWEETFNCHLQEGAKGPL
PVDTFLRGHEESGDRFSNSSTAFRPLCTGDENISSVETPYIDYTHLRISYNVYLAVYSIA
HALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGN
YSIINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEEKILWSGFSREVPFSNCSRDCLA
GTRKGIIEGEPTCCFECVECPDGEYSDETDASACNKCPDDFWSNENHTSCIAKEIEFLSW
TEPFGIALTLFAVLGIFLTAFVLGVFIKFRNTPIVKATNRELSYLLLFSLLCCFSSSLFF
IGEPQDWTCRLRQPAFGISFVLCISCILVKTNRVLLVFEAKIPTSFHRKWWGLNLQFLLV
FLCTFMQIVICVIWLYTAPPSSYRNQELEDEIIFITCHEGSLMALGFLIGYTCLLAAICF
FFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIAILAASFGL
LACIFFNKIYIILFKPSRNTIEEVRCSTAAHAFKVAARATLRRSNVTSTSVTSVNQASTS
RLEGLQSENHRLRMKITELDKDLEEVTMQLQDTPEKKTN

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	5
CA	Calcium ion	Ca	8
TRP	Tryptophan	C11 H12 N2 O2	2
PO4	Phosphate ion	O4 P	2
A1ATX	(1R)-1-(2H-1,3-benzodioxol-4-yl)-N-[2-(1,2-benzothiazol-3-yl)ethyl]ethan-1-amine	C18 H18 N2 O2 S	2

Primary citation

Large library docking identifies positive allosteric modulators of the calcium-sensing receptor. Liu, F., Wu, C.G., Tu, C.L. et al. Science (2024) 385:eado1868-eado1868. DOI 10.1126/science.ado1868 · PubMed

Other PDB entries of the same protein (UniProt P41180 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5FBK 2.1 Å, Crystal structure of the extracellular domain of human calcium sensing receptor
7M3G 2.5 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
5K5S 2.6 Å, Crystal structure of the active form of human calcium-sensing receptor extracellular…
5FBH 2.7 Å, Crystal structure of the extracellular domain of human calcium sensing receptor with…
7SIL 2.7 Å, Structure of positive allosteric modulator-bound active human calcium-sensing receptor
7SIM 2.7 Å, Structure of positive allosteric modulator-free active human calcium-sensing receptor
8WPG 2.7 Å, Human calcium-sensing receptor bound with cinacalcet in detergent
7M3F 2.8 Å, Asymmetric Activation of the Calcium Sensing Receptor Homodimer
8SZF 2.8 Å, Cryo-EM structure of cinacalcet-bound active-state human calcium-sensing receptor CaSR…
9C1P 2.8 Å, Structure of Calcium-Sensing Receptor in complex with positive allosteric modulator '6218
7E6T 3.0 Å, Structural insights into the activation of human calcium-sensing receptor
5K5T 3.1 Å, Crystal structure of the inactive form of human calcium-sensing receptor extracellular…

Browse structure collections

About this viewer

MolViewer shows 9C2F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.