Galectin-8 N-terminal domain carbohydrate recognition domain. Determined by X-ray diffraction at 1.32 Å resolution. Released 21 Dec 2016.
Explore 5GZE in 3D Show helices and sheets RCSB PDB PDBe
5GZE contains 2 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-20 | 5 | 1 |
| α-helix | 22-23 | 2 | |
| β-strand | 26-29 | 4 | 2 |
| β-strand | 39-45 | 7 | 1 |
| β-strand | 52-63 | 12 | 2 |
| β-strand | 66-76 | 11 | 2 |
| β-strand | 82-89 | 8 | 2 |
| β-strand | 92-93 | 2 | 2 |
| β-strand | 97-99 | 3 | 2 |
| β-strand | 109-116 | 8 | 1 |
| β-strand | 120-125 | 6 | 1 |
| β-strand | 128-134 | 7 | 1 |
| α-helix | 139-141 | 3 | |
| β-strand | 144-149 | 6 | 2 |
| β-strand | 152-159 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Galectin-8 | A | protein | 148 | Homo sapiens | O00214 (AlphaFold model) |
>5GZE_1 Galectin-8 (chains A) NLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHF NPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLY GHRIGPEKIDTLGIYGKVNIHSIGFSFS
Crystallization of Galectin-8 Linker Reveals Intricate Relationship between the N-terminal Tail and the Linker. Si, Y., Wang, Y., Gao, J. et al. Int J Mol Sci (2016) 17. DOI 10.3390/ijms17122088 · PubMed
Other PDB entries of the same protein (UniProt O00214 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5GZE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.