5H75: MrsD-Protein A fusion protein

Crystal structure of the MrsD-Protein A fusion protein. Determined by X-ray diffraction at 2.74 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.74 Å
Organisms: Bacillus sp. (strain HIL-Y85/54728), Staphylococcus aureus
Chains: 4
Atoms: 6,812
Mol. weight: 108.21 kDa
Ligands: FAD
Released: 28 Jun 2017

Explore 5H75 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H75 contains 63 α-helices and 33 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	1
α-helix	19-23	5
α-helix	25-32	8
β-strand	37-42	6	1
α-helix	44-49	6
α-helix	52-55	4
α-helix	56-58	3
β-strand	61-63	3	1
α-helix	78-81	4
β-strand	84-90	7	1
α-helix	92-99	8
α-helix	106-113	8
β-strand	118-122	5	1
α-helix	126-129	4
α-helix	132-143	12
β-strand	147-148	2	1
α-helix	149-151	3
β-strand	152-155	4	2
β-strand	166-169	4	2
α-helix	170-172	3
α-helix	173-190	18
α-helix	197-205	9
α-helix	211-213	3
α-helix	214-226	13

Chain B: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	3
α-helix	19-23	5
α-helix	24-32	9
β-strand	37-42	6	3
α-helix	44-49	6
α-helix	52-56	5
β-strand	61-63	3	3
α-helix	78-81	4
β-strand	84-90	7	3
α-helix	92-100	9
α-helix	106-113	8
β-strand	118-122	5	3
α-helix	126-129	4
α-helix	132-143	12
β-strand	147-148	2	3
α-helix	149-151	3
β-strand	152	1	4
β-strand	169	1	4
α-helix	170-172	3
α-helix	173-190	18
α-helix	197-205	9
α-helix	211-213	3
α-helix	214-226	13

Chain C: 15 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	10-15	6	5
α-helix	19-23	5
α-helix	25-32	8
β-strand	37-42	6	5
α-helix	44-49	6
α-helix	52-56	5
β-strand	61-63	3	5
α-helix	78-81	4
β-strand	84-90	7	5
α-helix	92-99	8
α-helix	106-113	8
β-strand	118-122	5	5
α-helix	126-129	4
α-helix	132-143	12
β-strand	147-148	2	5
α-helix	149-151	3
β-strand	152	1	6
β-strand	169	1	6
α-helix	170-172	3
α-helix	173-190	18
α-helix	197-205	9
α-helix	211-213	3
α-helix	214-226	13

Chain D: 17 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	10-15	6	7
α-helix	19-23	5
α-helix	25-32	8
β-strand	37-42	6	7
α-helix	44-49	6
α-helix	52-55	4
α-helix	56-58	3
β-strand	61-63	3	7
α-helix	78-81	4
β-strand	84-90	7	7
α-helix	92-99	8
α-helix	106-113	8
β-strand	118-122	5	7
β-strand	124-125	2	8
α-helix	126-129	4
α-helix	132-143	12
β-strand	147-148	2	7
α-helix	149-151	3
β-strand	152-158	7	8
β-strand	163-169	7	8
α-helix	170-172	3
α-helix	173-190	18
α-helix	197-209	13
α-helix	211-213	3
α-helix	214-227	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mersacidin decarboxylase,Immunoglobulin G-binding protein A	A, B, C, D	protein	238	Bacillus sp. (strain HIL-Y85/54728), Staphylococcus aureus	P38507 (AlphaFold model), Q9RC23 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5H75_1 Mersacidin decarboxylase,Immunoglobulin G-binding protein A (chains A, B, C, D)
GSGGGGSMSISILKDKKLLIGICGSISSVGISSYLLYFKSFFKEIRVVMTKTAEDLIPAH
TVSYFCDHVYSEHGENGKRHSHVEIGRWADIYCIIPATANILGQTANGVAMNLVATTVLA
HPHNTIFFPNMNDLMWNKTVVSRNIEQLRKDGHIVIEPVEIMAFEIATGTRKPNRGLITP
DKALLAIEQGFAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNDAQAPK

Ligands and cofactors

ID	Name	Formula	Copies
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	4

Primary citation

Construction of novel repeat proteins with rigid and predictable structures using a shared helix method. Youn, S.J., Kwon, N.Y., Lee, J.H. et al. Sci Rep (2017) 7:2595-2595. DOI 10.1038/s41598-017-02803-z · PubMed

Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NPD 0.9 Å, High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
4NPE 1.42 Å, High-resolution structure of C domain of staphylococcal protein A at room temperature
4NPF 1.49 Å, High-resolution structure of two tandem B domains of staphylococcal protein A connected…
8CPL 1.6 Å, YZw2 a scaffold for cryo-EM of small proteins of interest
4ZMD 1.87 Å, C domain of staphylococcal protein A mutant - Q9W
4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
1LP1 2.3 Å, Protein Z in complex with an in vitro selected affibody
5CBN 2.3 Å, Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with…
4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…
5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex
5EWX 2.6 Å, Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with…
5H76 2.6 Å, Crystal structure of the DARPin-Protein A fusion protein

Browse structure collections

About this viewer

MolViewer shows 5H75 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.