5H79: Immunoglobulin G-binding protein A

Crystal structure of a repeat protein with three Protein A repeat module. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.7 Å
Organism: Staphylococcus aureus
Chains: 2
Atoms: 2,282
Mol. weight: 33.06 kDa
Released: 28 Jun 2017

Explore 5H79 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H79 contains 19 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	37-47	11
α-helix	54-66	13
α-helix	68-70	3
α-helix	71-92	22
α-helix	99-111	13
α-helix	113-115	3
α-helix	116-137	22
α-helix	144-156	13
α-helix	158-160	3
α-helix	161-174	14

Chain D: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	37-47	11
α-helix	54-66	13
α-helix	68-70	3
α-helix	71-92	22
α-helix	99-111	13
α-helix	116-138	23
α-helix	144-156	13
α-helix	158-160	3
α-helix	161-174	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein A	C, D	protein	146	Staphylococcus aureus	P38507 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>5H79_1 Immunoglobulin G-binding protein A (chains C, D)
GSHMNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNEQQAAFYEI
LSLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNEQQAAFYEILHLPNLNEEQRNAFI
QSLKDDPSQSANLLAEAKKLNDAQAP

Primary citation

Construction of novel repeat proteins with rigid and predictable structures using a shared helix method. Youn, S.J., Kwon, N.Y., Lee, J.H. et al. Sci Rep (2017) 7:2595-2595. DOI 10.1038/s41598-017-02803-z · PubMed

Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NPD 0.9 Å, High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
4NPE 1.42 Å, High-resolution structure of C domain of staphylococcal protein A at room temperature
4NPF 1.49 Å, High-resolution structure of two tandem B domains of staphylococcal protein A connected…
8CPL 1.6 Å, YZw2 a scaffold for cryo-EM of small proteins of interest
4ZMD 1.87 Å, C domain of staphylococcal protein A mutant - Q9W
4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
1LP1 2.3 Å, Protein Z in complex with an in vitro selected affibody
5CBN 2.3 Å, Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with…
4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…
5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex
5EWX 2.6 Å, Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with…
5H76 2.6 Å, Crystal structure of the DARPin-Protein A fusion protein

Browse structure collections

About this viewer

MolViewer shows 5H79 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.