5H7A: Repeat protein with four Protein A repeat module

Crystal structure of a repeat protein with four Protein A repeat module. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Jun 2017.

Method

X-ray diffraction

Resolution

2.7 Å

Organism

Staphylococcus aureus

Chains

12

Atoms

18,409

Mol. weight

262.07 kDa

Released

28 Jun 2017

Explore 5H7A in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H7A contains 150 α-helices and 0 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Molecules and chains

>5H7A_1 Immunoglobulin G-binding protein A (chains A, B, C, D, E, F, G, H, I, J, K, L)
GSHMKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNEQQAAFY
EILSLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKKLNEQQAAFYEILHLPNLNEEQRNA
FIQSLKDDPSQSANLLAEAKKLNEQQAAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANL
LAEAKKLNDAQA

Primary citation

Construction of novel repeat proteins with rigid and predictable structures using a shared helix method. Youn, S.J., Kwon, N.Y., Lee, J.H. et al. Sci Rep (2017) 7:2595-2595. DOI 10.1038/s41598-017-02803-z · PubMed

Related structures

Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

• 4NPD 0.9 Å, High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
• 4NPE 1.42 Å, High-resolution structure of C domain of staphylococcal protein A at room temperature
• 4NPF 1.49 Å, High-resolution structure of two tandem B domains of staphylococcal protein A connected…
• 8CPL 1.6 Å, YZw2 a scaffold for cryo-EM of small proteins of interest
• 4ZMD 1.87 Å, C domain of staphylococcal protein A mutant - Q9W
• 4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
• 1LP1 2.3 Å, Protein Z in complex with an in vitro selected affibody
• 5CBN 2.3 Å, Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with…
• 4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…
• 5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex
• 5EWX 2.6 Å, Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with…
• 5H76 2.6 Å, Crystal structure of the DARPin-Protein A fusion protein

Browse structure collections

About this viewer

MolViewer shows 5H7A directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.