5H7C: Immunoglobulin G-binding protein A, DHR14

Crystal structure of a repeat protein with two Protein A-DHR14 repeat modules. Determined by X-ray diffraction at 2.7 Å resolution. Released 28 Jun 2017.

Method: X-ray diffraction
Resolution: 2.7 Å
Organisms: Staphylococcus aureus, synthetic construct
Chains: 2
Atoms: 6,284
Mol. weight: 90.73 kDa
Released: 28 Jun 2017

Explore 5H7C in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5H7C contains 42 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	7-18	12
α-helix	24-36	13
α-helix	38-40	3
α-helix	41-66	26
α-helix	70-85	16
α-helix	90-105	16
α-helix	110-125	16
α-helix	130-146	17
α-helix	150-165	16
α-helix	170-185	16
α-helix	190-214	25
α-helix	220-232	13
α-helix	234-236	3
α-helix	237-262	26
α-helix	266-282	17
α-helix	286-302	17
α-helix	306-322	17
α-helix	326-342	17
α-helix	346-362	17
α-helix	366-382	17
α-helix	386-402	17

Chain C: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	8-17	10
α-helix	24-36	13
α-helix	38-40	3
α-helix	41-65	25
α-helix	70-85	16
α-helix	90-106	17
α-helix	110-125	16
α-helix	130-145	16
α-helix	150-166	17
α-helix	171-185	15
α-helix	190-214	25
α-helix	220-232	13
α-helix	234-236	3
α-helix	237-261	25
α-helix	266-282	17
α-helix	286-302	17
α-helix	306-322	17
α-helix	326-342	17
α-helix	346-362	17
α-helix	366-382	17
α-helix	386-402	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Immunoglobulin G-binding protein A, DHR14	A, C	protein	404	Staphylococcus aureus, synthetic construct	P38507 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>5H7C_1 Immunoglobulin G-binding protein A, DHR14 (chains A, C)
GSHMKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLAEAKSLNVNQAVKQ
LAEKAKEATDKEEVIEIVKELAELAKQSTDSELVNEIVKQLAEVAKEATDKELVIYIVKI
LAELAKQSTDSELVNEIVKQLAEVAKEATDKELVIYIVKILAELAKQSTDSELVNEIVKQ
LEEVAKEATDKELVEHIEKILEELEQQSAFYEILSLPNLNEEQRNAFIQSLKDDPSQSAN
LLAEAKSLNVNQAVKQLAEKAKEATDKEEVIEIVKELAELAKQSTDSELVNEIVKQLAEV
AKEATDKELVIYIVKILAELAKQSTDSELVNEIVKQLAEVAKEATDKELVIYIVKILAEL
AKQSTDSELVNEIVKQLEEVAKEATDKELVEHIEKILEELKKQS

Primary citation

Construction of novel repeat proteins with rigid and predictable structures using a shared helix method. Youn, S.J., Kwon, N.Y., Lee, J.H. et al. Sci Rep (2017) 7:2595-2595. DOI 10.1038/s41598-017-02803-z · PubMed

Other PDB entries of the same protein (UniProt P38507 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NPD 0.9 Å, High-resolution structure of C domain of staphylococcal protein A at cryogenic temperature
4NPE 1.42 Å, High-resolution structure of C domain of staphylococcal protein A at room temperature
4NPF 1.49 Å, High-resolution structure of two tandem B domains of staphylococcal protein A connected…
8CPL 1.6 Å, YZw2 a scaffold for cryo-EM of small proteins of interest
4ZMD 1.87 Å, C domain of staphylococcal protein A mutant - Q9W
4ZNC 2.28 Å, Fc fragment of human IgG in complex with the C domain of staphylococcal protein A mutant…
1LP1 2.3 Å, Protein Z in complex with an in vitro selected affibody
5CBN 2.3 Å, Fusion protein of mbp3-16 and B4 domain of protein A from staphylococcal aureus with…
4WWI 2.31 Å, Crystal structure of the C domain of staphylococcal protein A in complex with the Fc…
5H7D 2.57 Å, Crystal structure of the YgjG-protein A-Zpa963-calmodulin complex
5EWX 2.6 Å, Fusion protein of T4 lysozyme and B4 domain of protein A from staphylococcal aureus with…
5H76 2.6 Å, Crystal structure of the DARPin-Protein A fusion protein

Browse structure collections

About this viewer

MolViewer shows 5H7C directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.