5IC1: Talin-1

Structural analysis of a talin triple domain module, E1794Y, E1797Y, Q1801Y mutant. Determined by X-ray diffraction at 2.2 Å resolution. Released 18 May 2016.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Mus musculus
Chains: 1
Atoms: 3,483
Mol. weight: 49.59 kDa
Released: 18 May 2016

Explore 5IC1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5IC1 contains 19 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1360-1374	15
α-helix	1375-1377	3
α-helix	1389-1415	27
α-helix	1419-1449	31
β-strand	1455	1	1
α-helix	1456-1459	4
α-helix	1464-1481	18
α-helix	1488-1515	28
α-helix	1519-1544	26
α-helix	1552-1576	25
α-helix	1582-1586	5
β-strand	1587	1	1
α-helix	1590-1622	33
α-helix	1627-1653	27
α-helix	1658-1683	26
α-helix	1688-1691	4
α-helix	1695-1722	28
α-helix	1724-1750	27
α-helix	1755-1782	28
α-helix	1786-1788	3
α-helix	1789-1818	30

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A	protein	469	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5IC1_1 Talin-1 (chains A)
GHMAPGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGISQN
AKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARANQA
IQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAKEVA
NSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISPEGR
AAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITSMRD
KAPGQLECETAIAALNSCLRDLDQASLAAVSQQLAPREGISQEALHTQMLTAVQEISHLI
EPLASAARAEASQLGHKVSQMAQYFEPLTLAAVGAASKTLSHPQQMALLDQTKTLAESAL
QLLYTAKEAGGNPKQAAHTQYALYEAVYMMTEAVEDLTTTLNEAASAAG

Primary citation

Structural and Functional Analysis of a Talin Triple-Domain Module Suggests an Alternative Talin Autoinhibitory Configuration. Zhang, H., Chang, Y.C., Huang, Q. et al. Structure (2016) 24:721-729. DOI 10.1016/j.str.2016.02.020 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex

Browse structure collections

About this viewer

MolViewer shows 5IC1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.