5JEM: Complex of IRF-3 with CBP

Complex of IRF-3 with CBP. Determined by X-ray diffraction at 2.5 Å resolution. Released 15 Jun 2016.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 8
Atoms: 7,872
Mol. weight: 116.2 kDa
Released: 15 Jun 2016

Explore 5JEM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5JEM contains 41 α-helices and 54 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	203-210	8	1
β-strand	213-221	9	1
β-strand	226-229	4	2
β-strand	241-244	4	2
α-helix	245-247	3
α-helix	248-250	3
α-helix	255-266	12
β-strand	272-277	6	2
β-strand	280-285	6	2
β-strand	289	1	3
β-strand	291-296	6	1
β-strand	309-310	2	1
β-strand	317-321	5	2
α-helix	322-333	12
α-helix	339-341	3
β-strand	343-348	6	1
α-helix	358-360	3
β-strand	363-369	7	1
α-helix	370-382	13
β-strand	395	1	4

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	203-210	8	5
β-strand	213-221	9	5
β-strand	226-229	4	6
β-strand	241-244	4	6
α-helix	245-247	3
α-helix	248-250	3
α-helix	255-266	12
β-strand	272-277	6	6
β-strand	280-285	6	6
β-strand	289	1	4
β-strand	291-296	6	5
β-strand	309-310	2	5
β-strand	317-321	5	6
α-helix	322-333	12
α-helix	339-341	3
β-strand	343-348	6	5
α-helix	358-360	3
β-strand	364-369	6	5
α-helix	370-382	13
β-strand	395	1	3

Chains C and F: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2066-2072	7
α-helix	2080-2092	13
α-helix	2094-2104	11

Chain D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2066-2071	6
α-helix	2080-2091	12
α-helix	2094-2104	11

Chain E: 7 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	202-210	9	7
β-strand	213-222	10	7
β-strand	226-229	4	8
β-strand	241-244	4	8
α-helix	245-247	3
α-helix	248-250	3
α-helix	255-266	12
β-strand	272-277	6	8
β-strand	280-285	6	8
β-strand	289	1	9
β-strand	291-296	6	7
β-strand	309-310	2	7
β-strand	317-321	5	8
α-helix	322-333	12
α-helix	339-341	3
β-strand	343-348	6	7
α-helix	358-360	3
β-strand	363-369	7	7
α-helix	370-381	12
β-strand	393	1	10
β-strand	395	1	11

Chain G: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	202-210	9	12
β-strand	213-222	10	12
β-strand	226-229	4	13
β-strand	241-244	4	13
α-helix	245-247	3
α-helix	248-250	3
α-helix	255-266	12
β-strand	272-277	6	13
β-strand	280-285	6	13
β-strand	289	1	11
β-strand	291-296	6	12
β-strand	309-310	2	12
α-helix	311-312	2
β-strand	317-321	5	13
α-helix	322-333	12
α-helix	339-341	3
β-strand	343-348	6	12
β-strand	350	1	10
α-helix	358-360	3
β-strand	363-369	7	12
α-helix	370-382	13
β-strand	395	1	9

Chain H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	2066-2071	6
α-helix	2080-2092	13
α-helix	2094-2104	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interferon regulatory factor 3	A, B, E, G	protein	213	Homo sapiens	Q14653 (AlphaFold model)
CREB-binding protein	C, D, F, H	protein	47	Homo sapiens	Q92793 (AlphaFold model)

Sequence of entity 1 (A, B, E, G), FASTA

>5JEM_1 Interferon regulatory factor 3 (chains A, B, E, G)
SEFENPLKRLLVPGEEWEFEVTAFYRGRQVFQQTISCPEGLRLVGSEVGDRTLPGWPVTL
PDPGMSLTDRGVMSYVRHVLSCLGGGLALWRAGQWLWAQRLGHCHTYWAVSEELLPNSGH
GPDGEVPKDKEGGVFDLGPFIVDLITFTEGSGRSPRYALWFCVGESWPQDQPWTKRLVMV
KVVPTCLRALVEMARVGGASELENTVDLHIENS

Sequence of entity 2 (C, D, F, H), FASTA

>5JEM_2 CREB-binding protein (chains C, D, F, H)
SALQDLLRTLKSPSSPQQQQQVLNILKSNPQLMAAFIKQRTAKYVAN

Primary citation

Structural basis for concerted recruitment and activation of IRF-3 by innate immune adaptor proteins. Zhao, B., Shu, C., Gao, X. et al. Proc Natl Acad Sci U S A (2016) 113:E3403-E3412. DOI 10.1073/pnas.1603269113 · PubMed

Other PDB entries of the same protein (UniProt Q14653 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6SJA 1.5 Å, Structure of HPV16 E6 oncoprotein in complex with IRF3 LxxLL motif
5JEL 1.6 Å, Phosphorylated TRIF in complex with IRF-3
7JFL 1.68 Å, Crystal structure of human phosphorylated IRF-3 bound to CBP
5JEO 1.72 Å, Phosphorylated Rotavirus NSP1 in complex with IRF-3
6SIV 1.75 Å, Structure of HPV16 E6 oncoprotein in complex with mutant IRF3 LxxLL motif
3A77 1.8 Å, The crystal structure of phosphorylated IRF-3
5JEJ 2.0 Å, Phosphorylated STING in complex with IRF-3 CTD
1QWT 2.1 Å, Auto-inhibitory interferon regulation factor-3 (IRF3) transactivation domain
1J2F 2.3 Å, X-ray crystal structure of IRF-3 and its functional implications
3QU6 2.3 Å, Crystal structure of IRF-3 DBD free form
2PI0 2.31 Å, Crystal Structure of IRF-3 bound to the PRDIII-I regulatory element of the human…
1ZOQ 2.37 Å, IRF3-CBP complex

Browse structure collections

About this viewer

MolViewer shows 5JEM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.