5L3X: Negative elongation factor subcomplex NELF-AC

Crystal structure of negative elongation factor subcomplex NELF-AC. Determined by X-ray diffraction at 2.75 Å resolution. Released 22 Jun 2016.

Method: X-ray diffraction
Resolution: 2.75 Å
Organism: Homo sapiens
Chains: 2
Atoms: 4,451
Mol. weight: 65.04 kDa
Released: 22 Jun 2016

Explore 5L3X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5L3X contains 41 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	9-17	9
α-helix	25-26	2
α-helix	29-32	4
α-helix	35-44	10
α-helix	45-47	3
α-helix	50-59	10
α-helix	60-62	3
α-helix	65-70	6
α-helix	72-82	11
α-helix	88-96	9
α-helix	100-103	4
α-helix	115-130	16
α-helix	135-138	4
α-helix	139-143	5
α-helix	146-153	8
α-helix	156-160	5
β-strand	164-165	2	1
α-helix	171-180	10

Chain B: 24 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	191-196	6
α-helix	198-215	18
α-helix	220-231	12
α-helix	235-248	14
α-helix	256-271	16
α-helix	277-283	7
α-helix	285-288	4
α-helix	290-302	13
α-helix	307-316	10
α-helix	322-324	3
α-helix	325-327	3
α-helix	331-341	11
α-helix	353-365	13
β-strand	367-370	4	2
β-strand	375-379	5	2
α-helix	383-399	17
α-helix	411-418	8
α-helix	421-436	16
α-helix	450-461	12
α-helix	463-465	3
α-helix	466-477	12
α-helix	486-504	19
α-helix	509-521	13
α-helix	527-538	12
β-strand	541-542	2	1
α-helix	547-557	11
α-helix	574-585	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Negative elongation factor A	A	protein	177	Homo sapiens	Q9H3P2 (AlphaFold model)
Negative elongation factor C/D	B	protein	405	Homo sapiens	Q8IXH7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5L3X_1 Negative elongation factor A (chains A)
ESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGTLHLPR
RTVDEMKGALMEIIQLASLDSDPWVLMVADILKSFPDTGSLNLELEEQNPNVQDILGELR
EKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQKS

Sequence of entity 2 (B), FASTA

>5L3X_2 Negative elongation factor C/D (chains B)
GEITSVSTACQQLEVFSRVLRTSLATILDGGEENLEKNLPEFAKMVCHGEHTYLFAQAMM
SVLAQEEQGGSAVRRIAQEVQRFAQEKGHDASQITLALGTAASYPRACQALGAMLSKGAL
NPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQDHKHKYIHILAYAAS
VVETWKKNKRVSINKDELKSTSKAVETVHNLCCNENKGASELVAELSTLYQCIRFPVVAM
GVLKWVDWTVSEPRYFQLQTDHTPVHLALLDEISTCHQLLHPQVLQLLVKLFETEHSALD
VMEQLELKKTLLDRMVHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPY
TSDFVQLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN

Primary citation

Architecture and RNA binding of the human negative elongation factor. Vos, S.M., Pollmann, D., Caizzi, L. et al. Elife (2016) 5. DOI 10.7554/eLife.14981 · PubMed

Other PDB entries of the same protein (UniProt Q9H3P2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8UHG 2.7 Å, Structure of paused transcription complex Pol II-DSIF-NELF - poised post-translocated
8UI0 2.7 Å, Structure of poised transcription complex Pol II-DSIF-NELF - pre-translocated
6GML 3.2 Å, Structure of paused transcription complex Pol II-DSIF-NELF
8UIS 3.23 Å, Structure of transcription complex Pol II-DSIF-NELF-TFIIS
9J0O 3.3 Å, Arrested elongation complex of mammalian RNA polymerase II with nucleosome (AEC1-nuc)
9J0P 3.3 Å, Arrested elongation complex of mammalian RNA polymerase II with nucleosome (AEC2-nuc)
9J0N 3.4 Å, Paused elongation complex of mammalian RNA polymerase II with nucleosome (PEC2-nuc)
8UHA 3.5 Å, Structure of paused transcription complex Pol II-DSIF-NELF - tilted
7PKS 3.6 Å, Structural basis of Integrator-mediated transcription regulation
8W8E 3.9 Å, human co-transcriptional RNA capping enzyme RNGTT
8RBX 4.1 Å, Structure of Integrator-PP2A bound to a paused RNA polymerase II-DSIF-NELF-nucleosome…
7YCX 4.18 Å, The structure of INTAC-PEC complex

Browse structure collections

About this viewer

MolViewer shows 5L3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.