5L6Y: Il13

il13 in complex with tralokinumab. Determined by X-ray diffraction at 1.99 Å resolution. Released 21 Dec 2016.

Method: X-ray diffraction
Resolution: 1.99 Å
Organism: Homo sapiens
Chains: 3
Atoms: 4,227
Mol. weight: 61.07 kDa
Released: 21 Dec 2016

Explore 5L6Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5L6Y contains 22 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-19	13
α-helix	27-30	4
β-strand	32-34	3	1
α-helix	43-50	8
α-helix	60-69	10
β-strand	88-90	3	1
α-helix	91-107	17

Chain H: 10 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	2
α-helix	7-9	3
β-strand	10-12	3	3
β-strand	18-25	8	2
α-helix	29-31	3
β-strand	32-39	8	3
β-strand	46-52	7	3
β-strand	57-59	3	3
β-strand	67-72	6	2
α-helix	73-75	3
β-strand	77-82	6	2
α-helix	84-86	3
β-strand	88-96	9	3
β-strand	103	1	3
β-strand	107-111	5	3
α-helix	123-125	3
β-strand	126	1	4
α-helix	127-128	2
β-strand	129-133	5	5
α-helix	138-139	2
β-strand	145-154	10	5
β-strand	155	1	4
β-strand	160-163	4	6
α-helix	164-166	3
β-strand	168	1	6
β-strand	172-174	3	5
α-helix	175-177	3
β-strand	178-179	2	5
β-strand	185-193	9	5
β-strand	204-209	6	6
α-helix	210-212	3
β-strand	214-219	6	6

Chain L: 7 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	7
β-strand	9-13	4	8
β-strand	19-24	6	7
α-helix	28-30	3
β-strand	34-38	5	8
β-strand	45-48	4	8
β-strand	49	1	9
β-strand	53	1	9
β-strand	62-67	6	7
β-strand	70-75	6	7
α-helix	80-82	3
β-strand	84-91	8	8
β-strand	96-98	3	8
β-strand	102-106	5	8
β-strand	113	1	10
α-helix	114-115	2
β-strand	116-120	5	11
α-helix	121-123	3
α-helix	124-128	5
β-strand	132-141	10	11
β-strand	142	1	10
β-strand	147-152	6	12
β-strand	155-157	3	12
β-strand	161-163	3	11
α-helix	164-166	3
β-strand	167-168	2	11
β-strand	174-182	9	11
α-helix	184-188	5
β-strand	193-199	7	12
β-strand	202-208	7	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-13	C	protein	112	Homo sapiens	P35225 (AlphaFold model)
tralokinumab FAb digest VH	H	protein	238	Homo sapiens
tralokiumab FAb digest VL	L	protein	214	Homo sapiens

Sequence of entity 1 (C), FASTA

>5L6Y_1 Interleukin-13 (chains C)
GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIE
KTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN

Sequence of entity 2 (H), FASTA

>5L6Y_2 tralokinumab FAb digest VH (chains H)
QVQLVQSGAEVKKPGASVKVSCKASGYTFTNYGLSWVRQAPGQGLEWMGWISANNGDTNY
GQEFQGRVTMTTDTSTSTAYMELRSLRSDDTAVYYCARDSSSSWARWFFDLWGRGTLVTV
SSASTKGPSVFPLAPISKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQ
SSGLYSLSSVVTVGPSSSLGTQTYICNVNHKPSNTKVDKRVESKYGPPSPSSPAPAKN

Sequence of entity 3 (L), FASTA

>5L6Y_3 tralokiumab FAb digest VL (chains L)
SYVLTQPPSVSVAPGKTARITCGGNIIGSKLVHWYQQKPGQAPVLVIYDDGDRPSGIPER
FSGSNSGNTATLTISRVEAGDEADYYCQVWDTGSDPVVFGGGTKLTVLGQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Primary citation

Structural Characterisation Reveals Mechanism of IL-13-Neutralising Monoclonal Antibody Tralokinumab as Inhibition of Binding to IL-13R alpha 1 and IL-13R alpha 2. Popovic, B., Breed, J., Rees, D.G. et al. J Mol Biol (2017) 429:208-219. DOI 10.1016/j.jmb.2016.12.005 · PubMed

Other PDB entries of the same protein (UniProt P35225 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3L5X 1.9 Å, Crystal structure of the complex between IL-13 and H2L6 FAB
4I77 1.9 Å, Lebrikizumab Fab bound to IL-13
3L5W 2.0 Å, Crystal structure of the complex between IL-13 and C836 FAB
4PS4 2.8 Å, Crystal structure of the complex between IL-13 and M1295 FAB
3BPO 3.0 Å, Crystal structure of the IL13-IL4R-IL13Ra ternary complex
5E4E 3.0 Å, Engineered Interleukin-13 bound to receptor
3LB6 3.05 Å, The structure of IL-13 in complex with IL-13Ralpha2
3G6D 3.2 Å, Crystal structure of the complex between CNTO607 Fab and IL-13
8BLQ 3.97 Å, Cryo-EM structure of the CODV-IL13-RefAb triple complex
1GA3 NMR structure of interleukin-13
1IJZ Solution Structure of Human IL-13
1IK0 Solution Structure of Human IL-13

Browse structure collections

About this viewer

MolViewer shows 5L6Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.