5LEF: Rab6A:Kif20A complex

Rab6A:Kif20A complex. Determined by X-ray diffraction at 2.09 Å resolution. Released 15 Nov 2017.

Method: X-ray diffraction
Resolution: 2.09 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 3,744
Mol. weight: 61.21 kDa
Ligands: GTP, IPA, MG
Released: 15 Nov 2017

Explore 5LEF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5LEF contains 17 α-helices and 16 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	12-19	8	1
α-helix	26-35	10
β-strand	48-56	9	1
β-strand	61-69	9	1
α-helix	73-78	6
α-helix	79-84	6
β-strand	88-94	7	1
α-helix	98-102	5
α-helix	104-115	12
β-strand	120-126	7	1
α-helix	131-133	3
α-helix	138-147	10
β-strand	151-155	5	1
β-strand	156	1	2
β-strand	161	1	2
α-helix	163-172	10

Chain B: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	15-19	5	3
α-helix	26-35	10
β-strand	48-53	6	3
β-strand	64-69	6	3
α-helix	73-78	6
α-helix	80-85	6
β-strand	88-94	7	3
α-helix	98-115	18
β-strand	120-126	7	3
α-helix	131-133	3
α-helix	138-148	11
β-strand	151-155	5	3
β-strand	156	1	4
β-strand	161	1	4
α-helix	163-171	9

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	601-644	44

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ras-related protein Rab-6A	A, B	protein	191	Homo sapiens	P20340 (AlphaFold model)
Kinesin-like protein KIF20A	C, D	protein	66	Mus musculus	P97329 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5LEF_1 Ras-related protein Rab-6A (chains A, B)
GAMGNPLRKFKLVFLGEQSVGKTSLITRFMYDSFDNTYQATIGIDFLSKTMYLEDRTVRL
QLWDTAGLERFRSLIPSYIRDSTVAVVVYDITNVNSFQQTTKWIDDVRTERGSDVIIMLV
GNKTDLADKRQVSIEEGERKAKELNVMFIETSAKAGYNVKQLFRRVAAALPGMESTQDRS
REDMIDIKLEK

Sequence of entity 2 (C, D), FASTA

>5LEF_2 Kinesin-like protein KIF20A (chains C, D)
GAMEQWCSERLDNQKELMEELYEEKLKILKESLTTFYQEQIQERDEKIEELETLLQEAKQ
QPAAQQ

Ligands and cofactors

ID	Name	Formula	Copies
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2
IPA	Isopropyl alcohol	C3 H8 O	1
MG	Magnesium ion	Mg	2

Water and common crystallization additives (GOL, SO4) are not listed.

Primary citation

Coupling fission and exit of RAB6 vesicles at Golgi hotspots through kinesin-myosin interactions. Miserey-Lenkei, S., Bousquet, H., Pylypenko, O. et al. Nat Commun (2017) 8:1254-1254. DOI 10.1038/s41467-017-01266-0 · PubMed

Other PDB entries of the same protein (UniProt P20340 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1YZQ 1.78 Å, GppNHp-Bound Rab6 GTPase
2GIL 1.82 Å, Structure of the extremely slow GTPase Rab6A in the GTP bound form at 1.8 resolution
4DKX 1.9 Å, Crystal Structure of the Rab 6A'(Q72L)
3BBP 3.0 Å, Rab6-GTP:GCC185 Rab binding domain complex
3CWZ 3.2 Å, Structure of RAB6(GTP)-R6IP1 complex

Browse structure collections

About this viewer

MolViewer shows 5LEF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.