5NL1: Shigella IpaA-VBS3/TBS

Shigella IpaA-VBS3/TBS in complex with the Talin VBS1 domain 488-512. Determined by X-ray diffraction at 2.5 Å resolution. Released 16 May 2018.

Method: X-ray diffraction
Resolution: 2.5 Å
Organisms: Mus musculus, Shigella flexneri
Chains: 12
Atoms: 7,396
Mol. weight: 127.88 kDa
Released: 16 May 2018

Explore 5NL1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5NL1 contains 36 α-helices and 0 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, E and F: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	490-512	23
α-helix	516-520	5
α-helix	526-561	36
α-helix	570-600	31
α-helix	606-626	21

Chain C: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	490-514	25
α-helix	518-520	3
α-helix	526-561	36
α-helix	570-600	31
α-helix	606-626	21

Chain D: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	490-512	23
α-helix	516-520	5
α-helix	526-560	35
α-helix	570-600	31
α-helix	606-626	21

Chains G, I and L: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	6-24	19

Chain H: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	5-23	19

Chain J: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	0-23	24

Chain K: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	0-24	25

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Talin-1	A, B, C, D, E, F	protein	156	Mus musculus	P26039 (AlphaFold model)
Invasin IpaA	G, H, I, J, K, L	protein	46	Shigella flexneri	P18010 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>5NL1_1 Talin-1 (chains A, B, C, D, E, F)
MHRGHMPPLTSAQQALTGTINSSMQAVQAAQATLDDFETLPPLGQDAASKAWRKNKMDES
KHEIHSQVDAITAGTASVVNLTAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLE
DEGGNGRPLLQAAKGLAGAVSELLRSAQPASAEPRQ

Sequence of entity 2 (G, H, I, J, K, L), FASTA

>5NL1_2 Invasin IpaA (chains G, H, I, J, K, L)
MGSSHHHHHHSSGLVPRGSHMTRETIFEASKKVTNSLSNLISLIGT

Primary citation

Shigella IpaA Binding to Talin Stimulates Filopodial Capture and Cell Adhesion. Valencia-Gallardo, C., Bou-Nader, C., Aguilar-Salvador, D.I. et al. Cell Rep (2019) 26:921-932.e6. DOI 10.1016/j.celrep.2018.12.091 · PubMed

Other PDB entries of the same protein (UniProt P26039 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SR0 1.49 Å, Mouse vinculin head domain 1 (VD1) (residues 2-258) with A50I mutation in complex with…
4W8P 1.5 Å, Crystal structure of RIAM TBS1 in complex with talin R7R8 domains
9DZ5 1.74 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
7V1A 1.84 Å, Stapled TBS peptide from RIAM bound to talin R7R8 domains
3DYJ 1.85 Å, Crystal Structure of the R11R12 Domains of Talin
8FSE 1.9 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain
3IVF 1.94 Å, Crystal structure of the talin head FERM domain
3S90 1.97 Å, Human vinculin head domain Vh1 (residues 1-252) in complex with murine talin (VBS33;…
5IC0 1.97 Å, Structural analysis of a talin triple domain module
8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
2X0C 2.0 Å, Crystal Structure of the R7R8 domains of Talin
4F7G 2.05 Å, Crystal structure of talin autoinhibition complex

Browse structure collections

About this viewer

MolViewer shows 5NL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.