5TQC: Transport factor karyopherin-beta 2

Name: PDB 5TQC: Crystal structure of transport factor karyopherin-beta 2 in complex with the PY-NLS of ribosomal protein L4 (RpL4)
Published: 2017-02-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Crystal structure of transport factor karyopherin-beta 2 in complex with the PY-NLS of ribosomal protein L4 (RpL4). Determined by X-ray diffraction at 3.0 Å resolution. Released 15 Feb 2017.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Homo sapiens, Chaetomium thermophilum
Chains: 2
Atoms: 6,750
Mol. weight: 101.3 kDa
Released: 15 Feb 2017

Explore 5TQC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5TQC contains 67 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 67 helices, 0 β-strands

Element	Residues	Length
α-helix	9-22	14
α-helix	27-42	16
α-helix	47-51	5
α-helix	52-56	5
α-helix	62-79	18
α-helix	85-96	12
α-helix	104-120	17
α-helix	123-125	3
α-helix	130-137	8
α-helix	142-158	17
α-helix	160-163	4
α-helix	172-179	8
α-helix	180-182	3
α-helix	188-198	11
α-helix	199-201	3
α-helix	207-210	4
α-helix	213-222	10
α-helix	229-245	17
α-helix	251-253	3
α-helix	254-265	12
α-helix	270-283	14
α-helix	289-292	4
α-helix	297-306	10
α-helix	310-311	2
α-helix	312-318	7
α-helix	375-390	16
α-helix	391-394	4
α-helix	395-405	11
α-helix	411-423	13
α-helix	429-432	4
α-helix	433-435	3
α-helix	436-446	11
α-helix	452-464	13
α-helix	466-471	6
α-helix	478-489	12
α-helix	494-511	18
α-helix	512-518	7
α-helix	519-528	10
α-helix	536-552	17
α-helix	553-556	4
α-helix	559-575	17
α-helix	577	1
α-helix	583-597	15
α-helix	598-604	7
α-helix	605-628	24
α-helix	634-636	3
α-helix	638-655	18
α-helix	656-659	4
α-helix	660-664	5
α-helix	668-675	8
α-helix	681-697	17
α-helix	699-702	4
α-helix	703-705	3
α-helix	706-715	10
α-helix	722-739	18
α-helix	741-746	6
α-helix	748-759	12
α-helix	765-781	17
α-helix	783-786	4
α-helix	787-789	3
α-helix	790-800	11
α-helix	808-823	16
α-helix	826-830	5
α-helix	832-840	9
α-helix	847-864	18
α-helix	867-873	7
α-helix	878-887	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transportin-1,Transportin-1	A	protein	866	Homo sapiens	Q92973 (AlphaFold model)
60S ribosomal protein L4-like protein	B	protein	26	Chaetomium thermophilum	G0SFC3 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5TQC_1 Transportin-1,Transportin-1 (chains A)
MEYEWKPDEQGLQQILQLLKESQSPDTTIQRTVQQKLEQLNQYPDFNNYLIFVLTKLKSE
DEPTRSLSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVGILITTIASK
GELQNWPDLLPKLCSLLDSEDYNTCEGAFGALQKICEDSAEILDSDVLDRPLNIMIPKFL
QFFKHSSPKIRSHAVACVNQFIISRTQALMLHIDSFIENLFALAGDEEPEVRKNVCRALV
MLLEVRMDRLLPHMHNIVEYMLQRTQDQDENVALEACEFWLTLAEQPICKDVLVRHLPKL
IPVLVNGMKYSDIDIILLKGDVEEDETIPDSEQDIGGSGGSGDDTISDWNLRKCSAAALD
VLANVYRDELLPHILPLLKELLFHHEWVVKESGILVLGAIAEGCMQGMIPYLPELIPHLI
QCLSDKKALVRSITCWTLSRYAHWVVSQPPDTYLKPLMTELLKRILDSNKRVQEAACSAF
ATLEEEACTELVPYLAYILDTLVFAFSKYQHKNLLILYDAIGTLADSVGHHLNKPEYIQM
LMPPLIQKWNMLKDEDKDLFPLLECLSSVATALQSGFLPYCEPVYQRCVNLVQKTLAQAM
LNNAQPDQYEAPDKDFMIVALDLLSGLAEGLGGNIEQLVARSNILTLMYQCMQDKMPEVR
QSSFALLGDLTKACFQHVKPCIADFMPILGTNLNPEFISVCNNATWAIGEISIQMGIEMQ
PYIPMVLHQLVEIINRPNTPKTLLENTAITIGRLGYVCPQEVAPMLQQFIRPWCTSLRNI
RDNEEKDSAFRGICTMISVNPSGVIQDFIFFCDAVASWINPKDDLRDMFCKILHGFKNQV
GDENWRRFSDQFPLPLKERLAAFYGV

Sequence of entity 2 (B), FASTA

>5TQC_2 60S ribosomal protein L4-like protein (chains B)
SRTKRACVQKKNPLRNKQIMLRLNPY

Primary citation

Molecular basis for protection of ribosomal protein L4 from cellular degradation. Huber, F.M., Hoelz, A. Nat Commun (2017) 8:14354-14354. DOI 10.1038/ncomms14354 · PubMed

Other PDB entries of the same protein (UniProt Q92973 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4FDD 2.3 Å, Crystal structure of KAP beta2-PY-NLS
2Z5K 2.6 Å, Complex of Transportin 1 with TAP NLS
4OO6 2.7 Å, Crystal structure of human KAP-beta2 bound to the NLS of HCC1 (Hepato Cellular Carcinoma…
7CYL 2.7 Å, Crystal structure of Karyopherin-beta2 in complex with FUS PY-NLS(P525L)
5YVI 2.9 Å, Crystal structure of Karyopherin beta2 in complex with FUS(456-526)
1QBK 3.0 Å, Structure of the karyopherin BETA2-ran gppnhp nuclear transport complex
2QMR 3.0 Å, Karyopherin beta2/transportin
2Z5M 3.0 Å, Complex of Transportin 1 with TAP NLS, crystal form 2
4FQ3 3.0 Å, Crystal structure of transportin/FUS-NLS
2H4M 3.05 Å, Karyopherin Beta2/Transportin-M9NLS
4JLQ 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the PY-NLS of Saccharomyces…
5J3V 3.05 Å, Crystal structure of human Karyopherin-beta2 bound to the histone H3 tail

Browse structure collections

About this viewer

MolViewer shows 5TQC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.