5VKG: Tumor susceptibility gene 101 protein

Solution-state NMR structural ensemble of human Tsg101 UEV in complex with tenatoprazole. Determined by solution NMR. Released 15 Nov 2017.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,185
Mol. weight: 16.89 kDa
Ligands: 4N1
Released: 15 Nov 2017

Explore 5VKG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5VKG contains 7 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
α-helix	18-31	14
β-strand	35-43	9	1
β-strand	49-63	15	1
β-strand	66-75	10	1
α-helix	76-77	2
α-helix	84-85	2
β-strand	86-89	4	1
β-strand	95-97	3	2
β-strand	103	1	3
β-strand	109	1	3
α-helix	112-115	4
α-helix	117-118	2
α-helix	123-134	12
β-strand	141-143	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor susceptibility gene 101 protein	A	protein	145	Homo sapiens	Q99816 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5VKG_1 Tumor susceptibility gene 101 protein (chains A)
GAVSESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIP
VPYRGNTYNIPICLWLLDTYPYNPPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHP
QSDLLGLIQVMIVVFGDEPPVFSRP

Ligands and cofactors

ID	Name	Formula	Copies
4N1	4-methoxy-1-(5-methoxy-3H-imidazo[4,5-b]pyridin-2-yl)-3,5-dimethyl-2-(sulfanylm…	C16 H19 N4 O2 S	1

Primary citation

Tsg101 chaperone function revealed by HIV-1 assembly inhibitors. Strickland, M., Ehrlich, L.S., Watanabe, S. et al. Nat Commun (2017) 8:1391-1391. DOI 10.1038/s41467-017-01426-2 · PubMed

Other PDB entries of the same protein (UniProt Q99816 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NLC 1.4 Å, Crystallographic structure of human Tsg101 UEV domain in complex with a HEV ORF3 peptide
3OBQ 1.4 Å, Crystal Structure of the Tsg101 UEV domain in complex with a human HRS PSAP peptide
3OBS 1.5 Å, Crystal structure of Tsg101 UEV domain
3OBU 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 PTAP peptide
3OBX 1.6 Å, Crystal structure of the Tsg101 UEV domain in complex with a HIV-1 Gag P7A mutant peptide
3P9G 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA459 peptide
3P9H 1.8 Å, Crystal structure of the TSG101 UEV domain in complex with FA258 peptide
1S1Q 2.0 Å, TSG101(UEV) domain in complex with Ubiquitin
4YC1 2.0 Å, Structure of the human TSG101-UEV domain in the P321 space group
6VME 2.19 Å, Human ESCRT-I heterotetramer headpiece
4EJE 2.2 Å, Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide
7ZLX 2.25 Å, Crystal Structure of the TSG101-UEV domain:space group P21

Browse structure collections

About this viewer

MolViewer shows 5VKG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.