5WLZ: DNA repair protein XRCC4,Myosin-7

Crystal Structure of Amino Acids 1677-1758 of Human Beta Cardiac Myosin Fused to Xrcc4. Determined by X-ray diffraction at 3.5 Å resolution. Released 23 Aug 2017.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 6,360
Mol. weight: 98.02 kDa
Released: 23 Aug 2017

Explore 5WLZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5WLZ contains 19 α-helices and 37 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	6
β-strand	10	1	7
β-strand	18-24	7	6
β-strand	32-37	6	6
β-strand	42-47	6	6
α-helix	49-58	10
α-helix	63-73	11
β-strand	84-89	6	7
β-strand	94-101	8	7
β-strand	104-112	9	7
α-helix	113	1
β-strand	114-115	2	6
α-helix	116	1
α-helix	119-1738	76

Chain B: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	8
β-strand	10	1	9
β-strand	18-24	7	8
α-helix	28-30	3
β-strand	31-37	7	8
β-strand	42-48	7	8
α-helix	49-57	9
α-helix	63-74	12
β-strand	83-85	3	9
β-strand	93-97	5	9
β-strand	107-112	6	9
β-strand	114-115	2	8
α-helix	116	1
α-helix	119-1736	74

Chain C: 4 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	18-25	8	1
β-strand	27-37	11	1
β-strand	42-48	7	1
α-helix	49-58	10
α-helix	63-74	12
β-strand	82-86	5	2
β-strand	94-98	5	2
β-strand	100	1	3
α-helix	101-103	3
β-strand	104	1	3
β-strand	107-111	5	2
β-strand	114-115	2	1
α-helix	119-1745	83

Chain D: 5 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	4
β-strand	10	1	5
β-strand	18-24	7	4
α-helix	28-30	3
β-strand	31-37	7	4
β-strand	42-48	7	4
α-helix	49-58	10
α-helix	63-74	12
β-strand	84-89	6	5
β-strand	94-100	7	5
β-strand	105-112	8	5
β-strand	114-115	2	4
α-helix	116	1
α-helix	119-1743	81

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA repair protein XRCC4,Myosin-7	A, B, C, D	protein	216	Homo sapiens	P12883 (AlphaFold model), Q13426 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>5WLZ_1 DNA repair protein XRCC4,Myosin-7 (chains A, B, C, D)
GSGERKISRIHLVSEPSITHFLQVSWEKTLKSGFVITLTDGHSAWTGTVSESKISQEAAT
MAMNKGKYVGELRKALLSGAGPADVYTFNFSKESRYFFFKKNLKDVSFRLGSFNLEKVEN
PAEVIRELIDYALDRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTS
LINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKA

Primary citation

Design considerations in coiled-coil fusion constructs for the structural determination of a problematic region of the human cardiac myosin rod. Andreas, M.P., Ajay, G., Gellings, J.A. et al. J Struct Biol (2017) 200:219-228. DOI 10.1016/j.jsb.2017.07.006 · PubMed

Other PDB entries of the same protein (UniProt P12883 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5CJ1 2.1 Å, Crystal structure of the coiled coil of MYH7 residues 1526 to 1571 fused to Gp7
6PF2 2.17 Å, Crystal Structure of Amino Acids 1220-1276 of Human Beta Cardiac Myosin Fused to Gp7 and…
6PFP 2.2 Å, Crystal Structure of Amino Acids 1473-1536 of Human Beta Cardiac Myosin Fused to Gp7 and…
4PA0 2.25 Å, Omecamtiv Mercarbil binding site on the Human Beta-Cardiac Myosin Motor Domain
5CHX 2.3 Å, Crystal Structure of amino acids 1590-1657 of MYH7
5CJ0 2.3 Å, Crystal Structure of Amino Acids 1631-1692 of MYH7
5WME 2.3 Å, Crystal Structure of Amino Acids 1729-1786 of Human Beta Cardiac Myosin Fused to Gp7 as…
4XA4 2.33 Å, Crystal Structure of the coiled-coil surrounding Skip 3 of MYH7
9HTF 2.48 Å, Beta-cardiac myosin Y115H mutant motor domain in the pre-powerstroke state, MgADP.VO4 form
2FXO 2.5 Å, Structure of the human beta-myosin S2 fragment
5WJ7 2.5 Å, Crystal Structure of Amino Acids 1733-1797 of Human Beta Cardiac Myosin Fused to Xrcc4
4XA3 2.55 Å, Crystal structure of the coiled-coil surrounding Skip 2 of MYH7

Browse structure collections

About this viewer

MolViewer shows 5WLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.