5Y4E: AnkB Ankyrin Repeats R8-14

Crystal Structure of AnkB Ankyrin Repeats R8-14 in complex with autoinhibition segment AI-b. Determined by X-ray diffraction at 2.34 Å resolution. Released 13 Sept 2017.

Method: X-ray diffraction
Resolution: 2.34 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,580
Mol. weight: 62.05 kDa
Released: 13 Sept 2017

Explore 5Y4E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Y4E contains 29 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	1269-1275	7
α-helix	1279-1287	9
α-helix	1302-1308	7
α-helix	1312-1320	9
α-helix	1335-1341	7
α-helix	1345-1353	9
α-helix	1368-1375	8
α-helix	1378-1386	9
α-helix	1396-1398	3
α-helix	1401-1407	7
α-helix	1411-1419	9
α-helix	1434-1441	8
α-helix	1444-1452	9
α-helix	1467-1473	7
α-helix	1477-1487	11

Chain B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	1269-1276	8
α-helix	1279-1287	9
α-helix	1302-1308	7
α-helix	1312-1320	9
α-helix	1335-1341	7
α-helix	1345-1353	9
α-helix	1368-1375	8
α-helix	1378-1386	9
α-helix	1401-1407	7
α-helix	1411-1419	9
α-helix	1434-1441	8
α-helix	1444-1452	9
α-helix	1467-1473	7
α-helix	1477-1486	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin-2,Ankyrin-2	A, B	protein	277	Homo sapiens	Q01484 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5Y4E_1 Ankyrin-2,Ankyrin-2 (chains A, B)
DGGEYLRPEDLKELGDDSLPSSQFLDGMNYLRYSLEGGRSLVPRGSGSRNGITPLHVASK
RGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP
LHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARA
LNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGA
SPDVTNIRGETALHMAARAGQVEVVRCLKVVTEEVTT

Primary citation

Autoinhibition of ankyrin-B/G membrane target bindings by intrinsically disordered segments from the tail regions. Chen, K., Li, J., Wang, C. et al. Elife (2017) 6. DOI 10.7554/eLife.29150 · PubMed

Other PDB entries of the same protein (UniProt Q01484 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KZJ 1.5 Å, Crystal structure of Ankyrin B/NdeL1 complex
5Y4F 1.95 Å, Crystal Structure of AnkB Ankyrin Repeats R13-24 in complex with autoinhibition segment…
8ZE8 2.07 Å, Arf-GTPase activating protein Asap1 SH3 domain in complex with 440 Kd Ankyrin-B fragment
5YIS 2.2 Å, Crystal Structure of AnkB LIR/LC3B complex
4D8O 2.2 Å, Crystal Structure of the ankyrin-B ZU5-ZU5-UPA-DD tandem
4RLY 2.5 Å, Crystal Structure of AnkB Ankyrin Repeats (R1-R9) in Complex with Nav1.2 Ankyrin Binding…
5YIR 2.75 Å, Crystal Structure of AnkB LIR/GABARAP complex
5Y4D 3.3 Å, Crystal Structure of AnkB Ankyrin Repeats in Complex with AnkR/AnkB Chimeric…
6M3Q 3.44 Å, Crystal structure of AnkB/beta4-spectrin complex
4RLV 3.49 Å, Crystal Structure of AnkB 24 Ankyrin Repeats in Complex with AnkR Autoinhibition Segment

Browse structure collections

About this viewer

MolViewer shows 5Y4E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.