5Y4F: AnkB Ankyrin Repeats R13-24

Crystal Structure of AnkB Ankyrin Repeats R13-24 in complex with autoinhibition segment AI-c. Determined by X-ray diffraction at 1.95 Å resolution. Released 13 Sept 2017.

Method: X-ray diffraction
Resolution: 1.95 Å
Organism: Homo sapiens
Chains: 2
Atoms: 6,407
Mol. weight: 94.81 kDa
Ligands: CA
Released: 13 Sept 2017

Explore 5Y4F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5Y4F contains 51 α-helices and 2 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	433-440	8
α-helix	443-451	9
α-helix	466-472	7
α-helix	476-484	9
α-helix	494-496	3
α-helix	499-505	7
α-helix	509-517	9
α-helix	532-539	8
α-helix	542-550	9
α-helix	565-572	8
α-helix	575-583	9
α-helix	598-604	7
α-helix	608-616	9
α-helix	631-638	8
α-helix	641-649	9
α-helix	664-671	8
α-helix	674-682	9
β-strand	690	1	1
β-strand	696	1	1
α-helix	697-704	8
α-helix	707-715	9
α-helix	730-737	8
α-helix	740-748	9
α-helix	763-769	7
α-helix	773-781	9
α-helix	796-802	7
α-helix	806-813	8

Chain B: 26 helices, 0 β-strands

Element	Residues	Length
α-helix	433-440	8
α-helix	443-451	9
α-helix	466-473	8
α-helix	476-484	9
α-helix	494-496	3
α-helix	499-505	7
α-helix	509-517	9
α-helix	532-539	8
α-helix	542-550	9
α-helix	565-572	8
α-helix	575-583	9
α-helix	598-604	7
α-helix	608-616	9
α-helix	631-637	7
α-helix	641-649	9
α-helix	664-671	8
α-helix	674-682	9
α-helix	697-703	7
α-helix	707-715	9
α-helix	730-737	8
α-helix	740-748	9
α-helix	763-769	7
α-helix	773-781	9
α-helix	796-803	8
α-helix	806-812	7
α-helix	826-828	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ankyrin-2	A, B	protein	444	Homo sapiens	Q01484 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>5Y4F_1 Ankyrin-2 (chains A, B)
SGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGAL
VDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVL
LEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQ
KVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLA
SQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGY
TPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNA
TTANGNTALAIAKRLGYISVVDTLKVVTEEVTTTTTTITEKHKLNVPETMTEVLDVSDEE
GDDTMTGDGGEYLRPEDLKELGDD

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	1

Water and common crystallization additives (ACT) are not listed.

Primary citation

Autoinhibition of ankyrin-B/G membrane target bindings by intrinsically disordered segments from the tail regions. Chen, K., Li, J., Wang, C. et al. Elife (2017) 6. DOI 10.7554/eLife.29150 · PubMed

Other PDB entries of the same protein (UniProt Q01484 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6KZJ 1.5 Å, Crystal structure of Ankyrin B/NdeL1 complex
8ZE8 2.07 Å, Arf-GTPase activating protein Asap1 SH3 domain in complex with 440 Kd Ankyrin-B fragment
5YIS 2.2 Å, Crystal Structure of AnkB LIR/LC3B complex
4D8O 2.2 Å, Crystal Structure of the ankyrin-B ZU5-ZU5-UPA-DD tandem
5Y4E 2.34 Å, Crystal Structure of AnkB Ankyrin Repeats R8-14 in complex with autoinhibition segment…
4RLY 2.5 Å, Crystal Structure of AnkB Ankyrin Repeats (R1-R9) in Complex with Nav1.2 Ankyrin Binding…
5YIR 2.75 Å, Crystal Structure of AnkB LIR/GABARAP complex
5Y4D 3.3 Å, Crystal Structure of AnkB Ankyrin Repeats in Complex with AnkR/AnkB Chimeric…
6M3Q 3.44 Å, Crystal structure of AnkB/beta4-spectrin complex
4RLV 3.49 Å, Crystal Structure of AnkB 24 Ankyrin Repeats in Complex with AnkR Autoinhibition Segment

Browse structure collections

About this viewer

MolViewer shows 5Y4F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.