Structure of tPA and PAI-1. Determined by X-ray diffraction at 3.58 Å resolution. Released 3 Apr 2019.
Explore 5ZLZ in 3D Show helices and sheets RCSB PDB PDBe
5ZLZ contains 24 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 17 | 1 | 5 |
| β-strand | 20-21 | 2 | 6 |
| β-strand | 30-36 | 7 | 7 |
| α-helix | 37 | 1 | |
| β-strand | 38-46 | 9 | 7 |
| β-strand | 51-54 | 4 | 7 |
| α-helix | 56-59 | 4 | |
| α-helix | 61-63 | 3 | |
| β-strand | 64-68 | 5 | 7 |
| β-strand | 72 | 1 | 8 |
| β-strand | 81-82 | 2 | 7 |
| β-strand | 85-90 | 6 | 7 |
| β-strand | 104-108 | 5 | 7 |
| β-strand | 122 | 1 | 6 |
| α-helix | 123-125 | 3 | |
| α-helix | 130-131 | 2 | |
| β-strand | 135-140 | 6 | 6 |
| β-strand | 154 | 1 | 8 |
| β-strand | 156-162 | 7 | 6 |
| α-helix | 169A-171 | 4 | |
| β-strand | 180-184 | 5 | 6 |
| β-strand | 189 | 1 | 5 |
| β-strand | 198-203 | 6 | 6 |
| β-strand | 206-215 | 10 | 6 |
| β-strand | 221A | 1 | 9 |
| β-strand | 224 | 1 | 9 |
| α-helix | 225 | 1 | |
| β-strand | 226-230 | 5 | 6 |
| α-helix | 231-234 | 4 | |
| α-helix | 235-240 | 6 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-27 | 19 | |
| β-strand | 34 | 1 | 1 |
| α-helix | 36-47 | 12 | |
| α-helix | 52-62 | 11 | |
| α-helix | 72-81 | 10 | |
| β-strand | 94-99 | 6 | 2 |
| β-strand | 105 | 1 | 3 |
| α-helix | 110-117 | 8 | |
| β-strand | 122-123 | 2 | 2 |
| α-helix | 129-141 | 13 | |
| α-helix | 154-156 | 3 | |
| β-strand | 163-171 | 9 | 2 |
| α-helix | 178-180 | 3 | |
| β-strand | 185-190 | 6 | 1 |
| α-helix | 191 | 1 | |
| β-strand | 196-211 | 16 | 1 |
| β-strand | 214 | 1 | 4 |
| β-strand | 220 | 1 | 4 |
| β-strand | 221-227 | 7 | 1 |
| α-helix | 229-231 | 3 | |
| β-strand | 233-240 | 8 | 1 |
| α-helix | 247-251 | 5 | |
| α-helix | 256-262 | 7 | |
| β-strand | 267-276 | 10 | 1 |
| β-strand | 278-285 | 8 | 2 |
| α-helix | 287-291 | 5 | |
| α-helix | 296-298 | 3 | |
| β-strand | 310 | 1 | 3 |
| β-strand | 319-328 | 10 | 2 |
| α-helix | 349 | 1 | |
| β-strand | 350-353 | 4 | 1 |
| β-strand | 358-364 | 7 | 1 |
| β-strand | 369-376 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Plasminogen activator inhibitor 1 | I | protein | 374 | Homo sapiens | P05121 (AlphaFold model) |
| Tissue-type plasminogen activator | E | protein | 251 | Homo sapiens | P00750 (AlphaFold model) |
>5ZLZ_1 Plasminogen activator inhibitor 1 (chains I) SYVAHLASDFGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFK IDDKGMAPALRHLYKELMGPWNKDEISTTDAIFVQRDLKLVQGFMPHFFRLFRSTVKQVD FSEVERARFIINDWVKTHTKGMISHLLGTGAVDQLTRLVLVNALYFNGQWKTPFPDSSTH RRLFHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPYEKEV PLSALTNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQAD FTSLSDQEPLHVALALQKVKIEVNESGTVASSSTAVIVSARMAPEEIIIDRPFLFVVRHN PTGTVLFMGQVMEP
>5ZLZ_2 Tissue-type plasminogen activator (chains E) IKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQERFPPHHLTV ILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCAQESSVVRTVA LPPADLQLPDWTECELSGYGKHEALSPEYSERLKEAHVRLYPSSRCTSQHLLQRTVTDNM LCAGDTRSGGPQANLHDACQGDAGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVT NYLDWIRDNMR
Development of a PAI-1 trapping agent (PAItrap2) based on inactivated tPA-SPD and the crystal structure of PAItrap2 in complex with PAI-1. Min, L., Huang, M. To be published.
Other PDB entries of the same protein (UniProt P05121 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5ZLZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.