6BI7: PDB entry 6BI7

Crystal structure of Rev7-WT/Rev3 as a monomer under high-salt conditions. Determined by X-ray diffraction at 2.8 Å resolution. Released 1 Aug 2018.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 8
Atoms: 6,445
Mol. weight: 117.86 kDa
Released: 1 Aug 2018

Explore 6BI7 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

6BI7 contains 38 α-helices and 38 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	39-41	3
β-strand	42-47	6	1
β-strand	50-55	6	1
α-helix	58-76	19
β-strand	82-89	8	2
β-strand	94-103	10	2
α-helix	117-132	16
α-helix	133-136	4
α-helix	138-141	4
β-strand	144-153	10	2
β-strand	171-173	3	2
α-helix	174-175	2
α-helix	176-179	4
β-strand	185-193	9	2
β-strand	198-205	8	2

Chain B: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1991-1996	6	2
α-helix	1999-2002	4
α-helix	2003-2011	9

Chain C: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	39-41	3
β-strand	42-47	6	3
β-strand	50-55	6	3
α-helix	58-76	19
β-strand	82-88	7	4
β-strand	94-103	10	4
α-helix	120-132	13
α-helix	133-136	4
α-helix	138-140	3
β-strand	145-152	8	4
α-helix	163-167	5
β-strand	171-173	3	4
α-helix	174-175	2
α-helix	176-179	4
β-strand	185-193	9	4
β-strand	198-205	8	4

Chain D: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1992-1996	5	4
α-helix	1999-2002	4
α-helix	2003-2011	9

Chain E: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	39-41	3
β-strand	42-43	2	5
β-strand	47	1	6
β-strand	50	1	6
β-strand	54-55	2	5
α-helix	58-76	19
β-strand	82-87	6	7
β-strand	97-103	7	7
α-helix	117-132	16
α-helix	133-135	3
β-strand	146-151	6	7
β-strand	171-173	3	7
α-helix	174-175	2
α-helix	176-179	4
β-strand	185-193	9	7
β-strand	198-205	8	7

Chain F: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1994-1996	3	7
α-helix	1999-2000	2
α-helix	2003-2011	9

Chain G: 6 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	13-33	21
α-helix	39-41	3
β-strand	42-44	3	8
β-strand	53-55	3	8
α-helix	58-76	19
β-strand	82-88	7	9
β-strand	94-103	10	9
α-helix	119-132	14
α-helix	133-136	4
β-strand	145-150	6	9
β-strand	171-173	3	9
α-helix	174-175	2
β-strand	187-193	7	9
β-strand	198-203	6	9

Chain H: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	1994-1996	3	9
α-helix	1999-2002	4
α-helix	2003-2011	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mitotic spindle assembly checkpoint protein MAD2B	A, C, E, G	protein	227	Homo sapiens	Q9UI95 (AlphaFold model)
DNA polymerase zeta catalytic subunit	B, D, F, H	protein	28	Homo sapiens	O60673

Sequence of entity 1 (A, C, E, G), FASTA

>6BI7_1 Mitotic spindle assembly checkpoint protein MAD2B (chains A, C, E, G)
MGSSHHHHHHSQDPNSMTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQK
RKKYNVPVQMSCHPELNQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQ
PPLLSISSDSLLSHVEQLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQ
VIKDFPWILADEQDVHMHDPRLIPLKTMTSDILKMQLYVEERAHKGS

Sequence of entity 2 (B, D, F, H), FASTA

>6BI7_2 DNA polymerase zeta catalytic subunit (chains B, D, F, H)
MEDKKIVIMPCKCAPSRQLVQVWLQAKE

Primary citation

Rev7 dimerization is important for assembly and function of the Rev1/Pol zeta translesion synthesis complex. Rizzo, A.A., Vassel, F.M., Chatterjee, N. et al. Proc Natl Acad Sci U S A (2018) 115:E8191-E8200. DOI 10.1073/pnas.1801149115 · PubMed

Other PDB entries of the same protein (UniProt Q9UI95 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6BCD 1.43 Å, Crystal structure of Rev7-K44A/R124A/A135D in complex with Rev3-RBM2 (residues 1988-2014)
6BC8 1.68 Å, Crystal structure of Rev7-R124A/Rev3-RBM2 (residues 1988-2014) complex
6M7B 1.77 Å, Structure of REV7-R124A complexed with SHLD3(37-73)
3ABD 1.9 Å, Structure of human REV7 in complex with a human REV3 fragment in a monoclinic crystal
4EXT 1.9 Å, Structure of polymerase-interacting domain of human Rev1 in complex with translesional…
6M7A 1.9 Å, Structure of REV7-R124A complexed with SHLD3(28-73)
6VE5 2.0 Å, X-ray structure of human REV7 in complex with Shieldin3 (residues 41-74)
6NIF 2.0 Å, crystal structure of human REV7-RAN complex
5XPT 2.1 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a tetragonal crystal
6K07 2.24 Å, Crystal structure of REV7(R124A) in complex with a Shieldin3 fragment
6WS0 2.24 Å, Rational drug design of phenazopyridine derivatives as novel inhibitors of Rev1-CT
5XPU 2.3 Å, Crystal structure of MAD2L2/REV7 in complex with a CAMP fragment in a monoclinic crystal

Browse structure collections

About this viewer

MolViewer shows 6BI7 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.