6C6D: 20mer crystal structure of CC chemokine 5
20mer crystal structure of CC chemokine 5 (CCL5). Determined by X-ray diffraction at 5.5 Å resolution. Released 23 Jan 2019.
- Method
- X-ray diffraction
- Resolution
- 5.5 Å
- Organism
- Homo sapiens
- Chains
- 20
- Atoms
- 10,284
- Mol. weight
- 150.29 kDa
- Released
- 23 Jan 2019
Explore 6C6D in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
6C6D contains 57 α-helices and 81 β-strands across 20 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chains A, B, C, D, F, G, H, I, O, P, R and S: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-10 | 3 | 1 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 2 |
| β-strand | 39-43 | 5 | 2 |
| β-strand | 48-51 | 4 | 2 |
| α-helix | 56-66 | 11 | |
Chains E and Q: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-10 | 3 | 7 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 8 |
| β-strand | 39-43 | 5 | 8 |
| β-strand | 48-51 | 4 | 8 |
| α-helix | 56-67 | 12 | |
Chain J: 2 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-10 | 3 | 13 |
| α-helix | 18-20 | 3 | |
| β-strand | 24-29 | 6 | 15 |
| β-strand | 39-43 | 5 | 15 |
| β-strand | 48-51 | 4 | 15 |
| α-helix | 56-67 | 12 | |
Chains K and L: 2 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-10 | 3 | 16 |
| α-helix | 18-20 | 3 | |
| β-strand | 24-29 | 6 | 17 |
| β-strand | 39-43 | 5 | 17 |
| β-strand | 48-51 | 4 | 17 |
| α-helix | 56-66 | 11 | |
Chain M: 3 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6 | 1 | 22 |
| β-strand | 8 | 1 | 23 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 26-29 | 4 | 24 |
| β-strand | 39-42 | 4 | 24 |
| β-strand | 48-51 | 4 | 24 |
| α-helix | 56-66 | 11 | |
Chain N: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 10 | 1 | 23 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 24-29 | 6 | 22 |
| β-strand | 39-43 | 5 | 22 |
| β-strand | 48-51 | 4 | 22 |
| α-helix | 56-66 | 11 | |
Chain T: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 8-10 | 3 | 19 |
| α-helix | 18-20 | 3 | |
| α-helix | 21-23 | 3 | |
| β-strand | 26-29 | 4 | 21 |
| β-strand | 39-42 | 4 | 21 |
| β-strand | 48-51 | 4 | 21 |
| α-helix | 56-66 | 11 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| C-C motif chemokine 5 | A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T | protein | 65 | Homo sapiens | P13501 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T), FASTA
>6C6D_1 C-C motif chemokine 5 (chains A, B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T)
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYIN
SLEMS
Primary citation
20mer crystal structure of CC chemokine 5 (CCL5). Liang, W.G., Tang, W.J. To be published.
Other PDB entries of the same protein (UniProt P13501 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5COY 1.44 Å, Crystal structure of CC chemokine 5 (CCL5)
- 6STK 1.52 Å, Crystal structure of the CC-chemokine 5 (CCL5) E66S mutation
- 1B3A 1.6 Å, Total chemical synthesis and high-resolution crystal structure of the potent anti-HIV…
- 1EQT 1.6 Å, Met-rantes
- 6AEZ 1.63 Å, Crystal structure of human CCL5 trimer
- 1U4P 1.7 Å, Crystal Structure of human RANTES mutant K45E
- 2VXW 1.7 Å, Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-RANTES
- 1U4L 2.0 Å, human RANTES complexed to heparin-derived disaccharide I-S
- 1U4M 2.0 Å, human RANTES complexed to heparin-derived disaccharide III-S
- 1U4R 2.2 Å, Crystal Structure of human RANTES mutant 44-AANA-47
- 5UIW 2.2 Å, Crystal Structure of CC Chemokine Receptor 5 (CCR5) in complex with high potency HIV…
- 5L2U 2.28 Å, Oligomer crystal structure of CC chemokine 5 (CCL5)
Browse structure collections
About this viewer
MolViewer shows 6C6D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.