6CI1: Voltage-gated potassium channel subunit beta-2
The Structure of Full-Length Kv Beta 2.1 Determined by Cryogenic Electron Microscopy. Determined by electron microscopy at 4.9 Å resolution. Released 27 Feb 2019.
- Method
- Electron microscopy
- Resolution
- 4.9 Å
- Organism
- Rattus norvegicus
- Chains
- 8
- Atoms
- 2,608
- Mol. weight
- 291.53 kDa
- Released
- 27 Feb 2019
Explore 6CI1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Voltage-gated potassium channel subunit beta-2 | A, B, C, D, E, F, G, H | protein | 326 | Rattus norvegicus | P62483 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D, E, F, G, H), FASTA
>6CI1_1 Voltage-gated potassium channel subunit beta-2 (chains A, B, C, D, E, F, G, H)
LQFYRNLGKSGLRVSCLGLGTWVTFGGQITDEMAEHLMTLAYDNGINLFDTAEVYAAGKA
EVVLGNIIKKKGWRRSSLVITTKIFWGGKAETERGLSRKHIIEGLKASLERLQLEYVDVV
FANRPDPNTPMEETVRAMTHVINQGMAMYWGTSRWSSMEIMEAYSVARQFNLIPPICEQA
EYHMFQREKVEVQLPELFHKIGVGAMTWSPLACGIVSGKYDSGIPPYSRASLKGYQWLKD
KILSEEGRRQQAKLKELQAIAERLGCTLPQLAIAWCLRNEGVSSVLLGASNAEQLMENIG
AIQVLPKLSSSIVHEIDSILGNKPYS
Primary citation
The Structure of Full-Length Kv Beta 2.1 Determined by Cryogenic Electron Microscopy. Stagg, S.M., Spear, J.M., Mendez, J.H. To be published.
Other PDB entries of the same protein (UniProt P62483 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 3EAU 1.82 Å, Voltage-dependent K+ channel beta subunit in complex with cortisone
- 3EB3 2.0 Å, Voltage-dependent K+ channel beta subunit (W121A) in complex with cortisone
- 3EB4 2.0 Å, Voltage-dependent K+ channel beta subunit (I211R) in complex with cortisone
- 1EXB 2.1 Å, Structure of the cytoplasmic beta subunit-T1 assembly of voltage-dependent K channels
- 2R9R 2.4 Å, Shaker family voltage dependent potassium channel (kv1.2-kv2.1 paddle chimera channel)…
- 4JTA 2.5 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin
- 4JTD 2.54 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Lys27Met mutant of…
- 4JTC 2.56 Å, Crystal structure of Kv1.2-2.1 paddle chimera channel in complex with Charybdotoxin in Cs+
- 1QRQ 2.8 Å, Structure of a voltage-dependent K+ channel beta subunit
- 2A79 2.9 Å, Mammalian Shaker Kv1.2 potassium channel- beta subunit complex
- 3LNM 2.9 Å, F233W mutant of the Kv2.1 paddle-Kv1.2 chimera channel
- 3LUT 2.9 Å, A Structural Model for the Full-length Shaker Potassium Channel Kv1.2
Browse structure collections
About this viewer
MolViewer shows 6CI1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.